BLASTX nr result
ID: Angelica27_contig00017820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00017820 (320 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH90944.1 hypothetical protein Ccrd_007082 [Cynara cardunculus ... 60 3e-09 XP_017228747.1 PREDICTED: uncharacterized protein LOC108192737 [... 60 4e-09 KZM80525.1 hypothetical protein DCAR_032194 [Daucus carota subsp... 60 4e-09 OAY28995.1 hypothetical protein MANES_15G109800 [Manihot esculenta] 53 3e-06 XP_015577420.1 PREDICTED: uncharacterized protein LOC8282169 [Ri... 52 7e-06 XP_015878814.1 PREDICTED: uncharacterized protein LOC107415059 i... 51 7e-06 EEF38990.1 hypothetical protein RCOM_0343080 [Ricinus communis] 51 8e-06 XP_002285740.1 PREDICTED: uncharacterized protein LOC100260500 [... 51 1e-05 >KVH90944.1 hypothetical protein Ccrd_007082 [Cynara cardunculus var. scolymus] Length = 146 Score = 60.1 bits (144), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 228 MKSIFMRVLFCKIHCPSFICFCKPS 302 MKSIFMRVLFCKIHCPSFICFCKPS Sbjct: 1 MKSIFMRVLFCKIHCPSFICFCKPS 25 >XP_017228747.1 PREDICTED: uncharacterized protein LOC108192737 [Daucus carota subsp. sativus] Length = 147 Score = 60.1 bits (144), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 228 MKSIFMRVLFCKIHCPSFICFCKPS 302 MKSIFMRVLFCKIHCPSFICFCKPS Sbjct: 1 MKSIFMRVLFCKIHCPSFICFCKPS 25 >KZM80525.1 hypothetical protein DCAR_032194 [Daucus carota subsp. sativus] Length = 159 Score = 60.1 bits (144), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 228 MKSIFMRVLFCKIHCPSFICFCKPS 302 MKSIFMRVLFCKIHCPSFICFCKPS Sbjct: 1 MKSIFMRVLFCKIHCPSFICFCKPS 25 >OAY28995.1 hypothetical protein MANES_15G109800 [Manihot esculenta] Length = 156 Score = 52.8 bits (125), Expect = 3e-06 Identities = 23/30 (76%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = +3 Query: 219 CLLMKS--IFMRVLFCKIHCPSFICFCKPS 302 CL +K +FMRVLFCKIHCP FICFCKPS Sbjct: 3 CLGIKKNFLFMRVLFCKIHCPPFICFCKPS 32 >XP_015577420.1 PREDICTED: uncharacterized protein LOC8282169 [Ricinus communis] Length = 157 Score = 51.6 bits (122), Expect = 7e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +3 Query: 237 IFMRVLFCKIHCPSFICFCKPS 302 + MRVLFCKIHCPSFICFCKPS Sbjct: 12 LLMRVLFCKIHCPSFICFCKPS 33 >XP_015878814.1 PREDICTED: uncharacterized protein LOC107415059 isoform X2 [Ziziphus jujuba] Length = 118 Score = 50.8 bits (120), Expect = 7e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +3 Query: 243 MRVLFCKIHCPSFICFCKPS 302 MRVLFCKIHCPSFICFCKPS Sbjct: 1 MRVLFCKIHCPSFICFCKPS 20 >EEF38990.1 hypothetical protein RCOM_0343080 [Ricinus communis] Length = 125 Score = 50.8 bits (120), Expect = 8e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +3 Query: 243 MRVLFCKIHCPSFICFCKPS 302 MRVLFCKIHCPSFICFCKPS Sbjct: 1 MRVLFCKIHCPSFICFCKPS 20 >XP_002285740.1 PREDICTED: uncharacterized protein LOC100260500 [Vitis vinifera] CBI16544.3 unnamed protein product, partial [Vitis vinifera] Length = 134 Score = 50.8 bits (120), Expect = 1e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +3 Query: 243 MRVLFCKIHCPSFICFCKPS 302 MRVLFCKIHCPSFICFCKPS Sbjct: 1 MRVLFCKIHCPSFICFCKPS 20