BLASTX nr result
ID: Angelica27_contig00017698
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00017698 (392 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM92195.1 hypothetical protein DCAR_020440 [Daucus carota subsp... 61 3e-08 XP_017257750.1 PREDICTED: sphingoid long-chain bases kinase 1-li... 61 3e-08 >KZM92195.1 hypothetical protein DCAR_020440 [Daucus carota subsp. sativus] Length = 749 Score = 60.8 bits (146), Expect = 3e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 391 ELFPVAGQVITSLFPEQCRLIGHSAGTSCK 302 ELFPVAGQVITSLFPEQCRLIGHSAGTS K Sbjct: 720 ELFPVAGQVITSLFPEQCRLIGHSAGTSRK 749 >XP_017257750.1 PREDICTED: sphingoid long-chain bases kinase 1-like [Daucus carota subsp. sativus] XP_017257751.1 PREDICTED: sphingoid long-chain bases kinase 1-like [Daucus carota subsp. sativus] Length = 756 Score = 60.8 bits (146), Expect = 3e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 391 ELFPVAGQVITSLFPEQCRLIGHSAGTSCK 302 ELFPVAGQVITSLFPEQCRLIGHSAGTS K Sbjct: 727 ELFPVAGQVITSLFPEQCRLIGHSAGTSRK 756