BLASTX nr result
ID: Angelica27_contig00017641
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00017641 (289 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017255366.1 PREDICTED: uncharacterized protein LOC108225068 [... 59 2e-10 CDP05737.1 unnamed protein product [Coffea canephora] 52 5e-06 >XP_017255366.1 PREDICTED: uncharacterized protein LOC108225068 [Daucus carota subsp. sativus] XP_017255367.1 PREDICTED: uncharacterized protein LOC108225068 [Daucus carota subsp. sativus] KZM90068.1 hypothetical protein DCAR_022567 [Daucus carota subsp. sativus] Length = 184 Score = 58.9 bits (141), Expect(2) = 2e-10 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 36 MEVWYSLYSYGNSGWSSTRNEELQENDVWGVLGKA 140 ME YSLYS GNSGWSS RNEELQE DVWG LG++ Sbjct: 1 MEGRYSLYSPGNSGWSSARNEELQEEDVWGFLGQS 35 Score = 33.5 bits (75), Expect(2) = 2e-10 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = +2 Query: 134 ESKYISSRAGNPKDFSTYNAPHGHPT 211 +SKYISS A N FS YNAP G PT Sbjct: 34 QSKYISSEASN-STFSPYNAPRGLPT 58 >CDP05737.1 unnamed protein product [Coffea canephora] Length = 189 Score = 52.0 bits (123), Expect = 5e-06 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = +3 Query: 48 YSLYSYGNSGWSSTRNEELQENDVWGVLGKA 140 YSLY G+SGWS+ RNEE QE DVWG LG++ Sbjct: 8 YSLYRQGSSGWSTLRNEEFQEQDVWGTLGRS 38