BLASTX nr result
ID: Angelica27_contig00017230
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00017230 (404 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017231376.1 PREDICTED: probable pectate lyase 18 [Daucus caro... 60 6e-08 >XP_017231376.1 PREDICTED: probable pectate lyase 18 [Daucus carota subsp. sativus] KZN06626.1 hypothetical protein DCAR_007463 [Daucus carota subsp. sativus] Length = 403 Score = 60.1 bits (144), Expect = 6e-08 Identities = 31/49 (63%), Positives = 33/49 (67%) Frame = -3 Query: 402 LNGAFFKPXXXXXXXXXXXXXXXXARPSTLVGQLTSASGSLNCKKGSRC 256 LNGAFFKP ARPS+LVGQLT+ASGSLNCKKGSRC Sbjct: 355 LNGAFFKPSGAGASSSYSRASSLGARPSSLVGQLTTASGSLNCKKGSRC 403