BLASTX nr result
ID: Angelica27_contig00017146
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00017146 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017237473.1 PREDICTED: glutamate receptor 3.3-like [Daucus ca... 61 9e-09 XP_017257897.1 PREDICTED: glutamate receptor 3.3-like isoform X1... 60 3e-08 ONI05456.1 hypothetical protein PRUPE_5G008300 [Prunus persica] 53 8e-06 ONI05455.1 hypothetical protein PRUPE_5G008300 [Prunus persica] 53 8e-06 ONI05453.1 hypothetical protein PRUPE_5G008300 [Prunus persica] 53 9e-06 ONI05454.1 hypothetical protein PRUPE_5G008300 [Prunus persica] 53 9e-06 XP_008237957.1 PREDICTED: glutamate receptor 3.3 [Prunus mume] 53 9e-06 XP_006342151.1 PREDICTED: glutamate receptor 3.3 [Solanum tubero... 53 9e-06 >XP_017237473.1 PREDICTED: glutamate receptor 3.3-like [Daucus carota subsp. sativus] KZN01109.1 hypothetical protein DCAR_009863 [Daucus carota subsp. sativus] Length = 927 Score = 61.2 bits (147), Expect = 9e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +1 Query: 214 RPAVVNIGAVFTFDSTIGKASYFAIKEAVNDV 309 RPAVVNIGAVFTFDSTIGKASY+AIK+AV+DV Sbjct: 30 RPAVVNIGAVFTFDSTIGKASYYAIKQAVDDV 61 >XP_017257897.1 PREDICTED: glutamate receptor 3.3-like isoform X1 [Daucus carota subsp. sativus] KZM89649.1 hypothetical protein DCAR_022988 [Daucus carota subsp. sativus] Length = 907 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 214 RPAVVNIGAVFTFDSTIGKASYFAIKEAVNDV 309 RPAVVNIGAVFTFDSTIG ASYFAIK+AV DV Sbjct: 30 RPAVVNIGAVFTFDSTIGAASYFAIKQAVEDV 61 >ONI05456.1 hypothetical protein PRUPE_5G008300 [Prunus persica] Length = 613 Score = 52.8 bits (125), Expect = 8e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 214 RPAVVNIGAVFTFDSTIGKASYFAIKEAVNDV 309 RPAVVNIGA+FTFDSTIGK + AI+EAV DV Sbjct: 36 RPAVVNIGAIFTFDSTIGKVAKLAIEEAVKDV 67 >ONI05455.1 hypothetical protein PRUPE_5G008300 [Prunus persica] Length = 694 Score = 52.8 bits (125), Expect = 8e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 214 RPAVVNIGAVFTFDSTIGKASYFAIKEAVNDV 309 RPAVVNIGA+FTFDSTIGK + AI+EAV DV Sbjct: 36 RPAVVNIGAIFTFDSTIGKVAKLAIEEAVKDV 67 >ONI05453.1 hypothetical protein PRUPE_5G008300 [Prunus persica] Length = 909 Score = 52.8 bits (125), Expect = 9e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 214 RPAVVNIGAVFTFDSTIGKASYFAIKEAVNDV 309 RPAVVNIGA+FTFDSTIGK + AI+EAV DV Sbjct: 36 RPAVVNIGAIFTFDSTIGKVAKLAIEEAVKDV 67 >ONI05454.1 hypothetical protein PRUPE_5G008300 [Prunus persica] Length = 945 Score = 52.8 bits (125), Expect = 9e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 214 RPAVVNIGAVFTFDSTIGKASYFAIKEAVNDV 309 RPAVVNIGA+FTFDSTIGK + AI+EAV DV Sbjct: 36 RPAVVNIGAIFTFDSTIGKVAKLAIEEAVKDV 67 >XP_008237957.1 PREDICTED: glutamate receptor 3.3 [Prunus mume] Length = 945 Score = 52.8 bits (125), Expect = 9e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 214 RPAVVNIGAVFTFDSTIGKASYFAIKEAVNDV 309 RPAVVNIGA+FTFDSTIGK + AI+EAV DV Sbjct: 36 RPAVVNIGAIFTFDSTIGKVAKLAIEEAVKDV 67 >XP_006342151.1 PREDICTED: glutamate receptor 3.3 [Solanum tuberosum] XP_006342152.1 PREDICTED: glutamate receptor 3.3 [Solanum tuberosum] Length = 946 Score = 52.8 bits (125), Expect = 9e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 214 RPAVVNIGAVFTFDSTIGKASYFAIKEAVNDV 309 RPAVVN+GA+FTFDSTIG+A+ AI+EAV DV Sbjct: 43 RPAVVNVGAIFTFDSTIGRAAKIAIQEAVKDV 74