BLASTX nr result
ID: Angelica27_contig00017062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00017062 (298 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017231066.1 PREDICTED: protein indeterminate-domain 11-like i... 70 6e-12 XP_017231065.1 PREDICTED: protein indeterminate-domain 7-like is... 70 6e-12 >XP_017231066.1 PREDICTED: protein indeterminate-domain 11-like isoform X2 [Daucus carota subsp. sativus] Length = 461 Score = 70.1 bits (170), Expect = 6e-12 Identities = 36/40 (90%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +1 Query: 181 MSNISCASGNQTSASSSVNIIA-EINQPPLKRKRNLPGNP 297 MSNIS ASGNQTSASS VN+IA EINQPPLKRKRNLPGNP Sbjct: 1 MSNISSASGNQTSASSGVNLIAHEINQPPLKRKRNLPGNP 40 >XP_017231065.1 PREDICTED: protein indeterminate-domain 7-like isoform X1 [Daucus carota subsp. sativus] Length = 484 Score = 70.1 bits (170), Expect = 6e-12 Identities = 36/40 (90%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +1 Query: 181 MSNISCASGNQTSASSSVNIIA-EINQPPLKRKRNLPGNP 297 MSNIS ASGNQTSASS VN+IA EINQPPLKRKRNLPGNP Sbjct: 1 MSNISSASGNQTSASSGVNLIAHEINQPPLKRKRNLPGNP 40