BLASTX nr result
ID: Angelica27_contig00012787
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00012787 (410 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN08439.1 hypothetical protein DCAR_000985 [Daucus carota subsp... 80 6e-17 >KZN08439.1 hypothetical protein DCAR_000985 [Daucus carota subsp. sativus] Length = 106 Score = 80.1 bits (196), Expect = 6e-17 Identities = 41/55 (74%), Positives = 47/55 (85%), Gaps = 1/55 (1%) Frame = -2 Query: 358 VMSGSEGAYY-STFFCWKKLWNILEEIIKRFKTLIGYRSSASQSQDHAQPQNTQS 197 VMS SEGAY S+F CW+KLWNILE+IIKRFKT IG+ ASQSQDHAQPQ+T+S Sbjct: 6 VMSESEGAYSTSSFSCWRKLWNILEDIIKRFKTFIGF---ASQSQDHAQPQSTKS 57