BLASTX nr result
ID: Angelica27_contig00012726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00012726 (303 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM87760.1 hypothetical protein DCAR_024861 [Daucus carota subsp... 76 1e-14 XP_017216201.1 PREDICTED: rust resistance kinase Lr10-like isofo... 76 4e-14 XP_017216199.1 PREDICTED: rust resistance kinase Lr10-like isofo... 76 4e-14 >KZM87760.1 hypothetical protein DCAR_024861 [Daucus carota subsp. sativus] Length = 254 Score = 76.3 bits (186), Expect = 1e-14 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -3 Query: 130 IGNIRPPFYLKGQPHKWHGFKYELSCEKNRTILHFPTWQFPKF 2 IGNI PFYLKGQPH+WHGF YELSCE N TIL F T QF KF Sbjct: 35 IGNISQPFYLKGQPHRWHGFSYELSCENNHTILKFATIQFSKF 77 >XP_017216201.1 PREDICTED: rust resistance kinase Lr10-like isoform X2 [Daucus carota subsp. sativus] Length = 644 Score = 76.3 bits (186), Expect = 4e-14 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -3 Query: 130 IGNIRPPFYLKGQPHKWHGFKYELSCEKNRTILHFPTWQFPKF 2 IGNI PFYLKGQPH+WHGF YELSCE N TIL F T QF KF Sbjct: 35 IGNISQPFYLKGQPHRWHGFSYELSCENNHTILKFATIQFSKF 77 >XP_017216199.1 PREDICTED: rust resistance kinase Lr10-like isoform X1 [Daucus carota subsp. sativus] Length = 651 Score = 76.3 bits (186), Expect = 4e-14 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -3 Query: 130 IGNIRPPFYLKGQPHKWHGFKYELSCEKNRTILHFPTWQFPKF 2 IGNI PFYLKGQPH+WHGF YELSCE N TIL F T QF KF Sbjct: 35 IGNISQPFYLKGQPHRWHGFSYELSCENNHTILKFATIQFSKF 77