BLASTX nr result
ID: Angelica27_contig00012564
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00012564 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017254548.1 PREDICTED: protein argonaute 16-like [Daucus caro... 55 2e-06 XP_019159475.1 PREDICTED: protein argonaute 16 [Ipomoea nil] 53 8e-06 >XP_017254548.1 PREDICTED: protein argonaute 16-like [Daucus carota subsp. sativus] XP_017254549.1 PREDICTED: protein argonaute 16-like [Daucus carota subsp. sativus] KZM91499.1 hypothetical protein DCAR_021136 [Daucus carota subsp. sativus] Length = 917 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 2 AKKKLRNMRVKATHSNREFKITELSEKPCYE 94 AKK L+NMRVKATHSNREFKI LSEKPC E Sbjct: 310 AKKMLKNMRVKATHSNREFKIIGLSEKPCTE 340 >XP_019159475.1 PREDICTED: protein argonaute 16 [Ipomoea nil] Length = 893 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +2 Query: 2 AKKKLRNMRVKATHSNREFKITELSEKPC 88 AKK L+NMRVKATHSNREFKIT LSE PC Sbjct: 287 AKKMLKNMRVKATHSNREFKITGLSELPC 315