BLASTX nr result
ID: Angelica27_contig00011461
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00011461 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU30299.1 hypothetical protein MIMGU_mgv11b015559mg, partial [E... 101 2e-24 XP_012845873.1 PREDICTED: 36.4 kDa proline-rich protein [Erythra... 101 2e-24 XP_017235263.1 PREDICTED: 36.4 kDa proline-rich protein-like iso... 102 4e-24 XP_017235262.1 PREDICTED: 36.4 kDa proline-rich protein-like iso... 102 5e-24 XP_017235261.1 PREDICTED: translation initiation factor IF-2-lik... 102 8e-24 KZN05982.1 hypothetical protein DCAR_006819 [Daucus carota subsp... 102 8e-24 XP_017235260.1 PREDICTED: glycine-rich cell wall structural prot... 102 9e-24 XP_006355521.2 PREDICTED: 36.4 kDa proline-rich protein, partial... 99 2e-23 KZV37036.1 36.4 kDa proline-rich protein [Dorcoceras hygrometricum] 100 3e-23 XP_011081226.1 PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa proline-... 99 3e-23 XP_010055511.1 PREDICTED: 36.4 kDa proline-rich protein [Eucalyp... 99 5e-23 XP_009595816.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotia... 99 5e-23 XP_015962652.1 PREDICTED: 36.4 kDa proline-rich protein-like [Ar... 95 5e-23 XP_019156039.1 PREDICTED: 36.4 kDa proline-rich protein-like [Ip... 98 6e-23 XP_004245751.1 PREDICTED: 36.4 kDa proline-rich protein [Solanum... 99 6e-23 XP_004298649.1 PREDICTED: 36.4 kDa proline-rich protein [Fragari... 98 7e-23 XP_016569199.1 PREDICTED: 36.4 kDa proline-rich protein [Capsicu... 99 8e-23 XP_015084512.1 PREDICTED: 36.4 kDa proline-rich protein [Solanum... 99 9e-23 XP_018848326.1 PREDICTED: 36.4 kDa proline-rich protein [Juglans... 97 1e-22 XP_019234659.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotia... 99 1e-22 >EYU30299.1 hypothetical protein MIMGU_mgv11b015559mg, partial [Erythranthe guttata] Length = 226 Score = 101 bits (252), Expect = 2e-24 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV*FNYPDPF 175 LLELEAAICLCTTIRLKLLNLNIF+PLALQVLATCG+TPPPGFVCPPLV YP + Sbjct: 101 LLELEAAICLCTTIRLKLLNLNIFLPLALQVLATCGLTPPPGFVCPPLV---YPPEY 154 >XP_012845873.1 PREDICTED: 36.4 kDa proline-rich protein [Erythranthe guttata] Length = 217 Score = 101 bits (251), Expect = 2e-24 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIF+PLALQVLATCG+TPPPGFVCPPLV Sbjct: 169 LLELEAAICLCTTIRLKLLNLNIFLPLALQVLATCGLTPPPGFVCPPLV 217 >XP_017235263.1 PREDICTED: 36.4 kDa proline-rich protein-like isoform X4 [Daucus carota subsp. sativus] Length = 319 Score = 102 bits (255), Expect = 4e-24 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV Sbjct: 271 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 319 >XP_017235262.1 PREDICTED: 36.4 kDa proline-rich protein-like isoform X3 [Daucus carota subsp. sativus] Length = 329 Score = 102 bits (255), Expect = 5e-24 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV Sbjct: 281 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 329 >XP_017235261.1 PREDICTED: translation initiation factor IF-2-like isoform X2 [Daucus carota subsp. sativus] Length = 356 Score = 102 bits (255), Expect = 8e-24 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV Sbjct: 308 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 356 >KZN05982.1 hypothetical protein DCAR_006819 [Daucus carota subsp. sativus] Length = 359 Score = 102 bits (255), Expect = 8e-24 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV Sbjct: 311 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 359 >XP_017235260.1 PREDICTED: glycine-rich cell wall structural protein 1-like isoform X1 [Daucus carota subsp. sativus] Length = 366 Score = 102 bits (255), Expect = 9e-24 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV Sbjct: 318 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 366 >XP_006355521.2 PREDICTED: 36.4 kDa proline-rich protein, partial [Solanum tuberosum] Length = 236 Score = 99.4 bits (246), Expect = 2e-23 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIF+PLAL VLATCG+TPPPGFVCPPLV Sbjct: 188 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLTPPPGFVCPPLV 236 >KZV37036.1 36.4 kDa proline-rich protein [Dorcoceras hygrometricum] Length = 265 Score = 99.8 bits (247), Expect = 3e-23 Identities = 45/49 (91%), Positives = 49/49 (100%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAA+CLCTTIRLKLLNLNIF+PLALQVLATCG+TPPPGFVCPPL+ Sbjct: 217 LLELEAAVCLCTTIRLKLLNLNIFLPLALQVLATCGLTPPPGFVCPPLL 265 >XP_011081226.1 PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa proline-rich protein [Sesamum indicum] Length = 260 Score = 99.4 bits (246), Expect = 3e-23 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPL 202 LLELEAAICLCTTIRLKLLNLN+F+PLALQVLATCG+TPPPGFVCPPL Sbjct: 213 LLELEAAICLCTTIRLKLLNLNVFLPLALQVLATCGLTPPPGFVCPPL 260 >XP_010055511.1 PREDICTED: 36.4 kDa proline-rich protein [Eucalyptus grandis] KCW71993.1 hypothetical protein EUGRSUZ_E00446 [Eucalyptus grandis] Length = 276 Score = 99.4 bits (246), Expect = 5e-23 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPL 202 LLELEAAICLCT IRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPL Sbjct: 229 LLELEAAICLCTAIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPL 276 >XP_009595816.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotiana tomentosiformis] XP_016483181.1 PREDICTED: 36.4 kDa proline-rich protein-like [Nicotiana tabacum] Length = 260 Score = 99.0 bits (245), Expect = 5e-23 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIF+PLAL VLATCG+TPPPGF+CPPLV Sbjct: 212 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLTPPPGFICPPLV 260 >XP_015962652.1 PREDICTED: 36.4 kDa proline-rich protein-like [Arachis duranensis] Length = 119 Score = 95.1 bits (235), Expect = 5e-23 Identities = 43/48 (89%), Positives = 47/48 (97%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPL 202 LL+LEAAICLCT IR+KLLNLNIFIP+ALQVLATCG+TPPPGFVCPPL Sbjct: 71 LLDLEAAICLCTVIRIKLLNLNIFIPVALQVLATCGMTPPPGFVCPPL 118 >XP_019156039.1 PREDICTED: 36.4 kDa proline-rich protein-like [Ipomoea nil] Length = 220 Score = 97.8 bits (242), Expect = 6e-23 Identities = 43/49 (87%), Positives = 49/49 (100%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAA+CLCTTIR+KLLNLNIF+PLALQ+LATCG+TPPPGFVCPPL+ Sbjct: 172 LLELEAAVCLCTTIRIKLLNLNIFLPLALQLLATCGLTPPPGFVCPPLL 220 >XP_004245751.1 PREDICTED: 36.4 kDa proline-rich protein [Solanum lycopersicum] Length = 292 Score = 99.4 bits (246), Expect = 6e-23 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIF+PLAL VLATCG+TPPPGFVCPPLV Sbjct: 244 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLTPPPGFVCPPLV 292 >XP_004298649.1 PREDICTED: 36.4 kDa proline-rich protein [Fragaria vesca subsp. vesca] Length = 226 Score = 97.8 bits (242), Expect = 7e-23 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPL 202 LLELEAAICLCTTIRLKLLNLNIFIPLALQ L TCGITPPPGFVCPPL Sbjct: 179 LLELEAAICLCTTIRLKLLNLNIFIPLALQALITCGITPPPGFVCPPL 226 >XP_016569199.1 PREDICTED: 36.4 kDa proline-rich protein [Capsicum annuum] Length = 308 Score = 99.4 bits (246), Expect = 8e-23 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIF+PLAL VLATCG+TPPPGFVCPPLV Sbjct: 260 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLTPPPGFVCPPLV 308 >XP_015084512.1 PREDICTED: 36.4 kDa proline-rich protein [Solanum pennellii] Length = 316 Score = 99.4 bits (246), Expect = 9e-23 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIF+PLAL VLATCG+TPPPGFVCPPLV Sbjct: 268 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLTPPPGFVCPPLV 316 >XP_018848326.1 PREDICTED: 36.4 kDa proline-rich protein [Juglans regia] Length = 232 Score = 97.4 bits (241), Expect = 1e-22 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAA+CLCTTIR+KLLNLNIFIPLALQVL TCG+TPPPGFVCPPL+ Sbjct: 184 LLELEAAVCLCTTIRIKLLNLNIFIPLALQVLITCGMTPPPGFVCPPLL 232 >XP_019234659.1 PREDICTED: 36.4 kDa proline-rich protein [Nicotiana attenuata] Length = 315 Score = 99.0 bits (245), Expect = 1e-22 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 345 LLELEAAICLCTTIRLKLLNLNIFIPLALQVLATCGITPPPGFVCPPLV 199 LLELEAAICLCTTIRLKLLNLNIF+PLAL VLATCG+TPPPGF+CPPLV Sbjct: 267 LLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLTPPPGFICPPLV 315