BLASTX nr result
ID: Angelica27_contig00011372
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00011372 (276 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM89595.1 hypothetical protein DCAR_023042 [Daucus carota subsp... 70 4e-12 XP_017257916.1 PREDICTED: DExH-box ATP-dependent RNA helicase DE... 70 4e-12 >KZM89595.1 hypothetical protein DCAR_023042 [Daucus carota subsp. sativus] Length = 893 Score = 70.1 bits (170), Expect = 4e-12 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 271 STNRYRGRAPQNFSLPAYEAGLHGDTGPSGDSLKRRHRNYRS 146 STN YRGRAPQNFS PA E G+ G+ GP GDSLKRRHR YR+ Sbjct: 852 STNHYRGRAPQNFSRPASETGVQGEIGPGGDSLKRRHRTYRN 893 >XP_017257916.1 PREDICTED: DExH-box ATP-dependent RNA helicase DExH6-like [Daucus carota subsp. sativus] Length = 1242 Score = 70.1 bits (170), Expect = 4e-12 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 271 STNRYRGRAPQNFSLPAYEAGLHGDTGPSGDSLKRRHRNYRS 146 STN YRGRAPQNFS PA E G+ G+ GP GDSLKRRHR YR+ Sbjct: 1201 STNHYRGRAPQNFSRPASETGVQGEIGPGGDSLKRRHRTYRN 1242