BLASTX nr result
ID: Angelica27_contig00011307
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00011307 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017246927.1 PREDICTED: probable serine/threonine-protein kina... 79 5e-14 >XP_017246927.1 PREDICTED: probable serine/threonine-protein kinase At5g41260 [Daucus carota subsp. sativus] XP_017246998.1 PREDICTED: probable serine/threonine-protein kinase At5g41260 [Daucus carota subsp. sativus] XP_017247071.1 PREDICTED: probable serine/threonine-protein kinase At5g41260 [Daucus carota subsp. sativus] Length = 483 Score = 78.6 bits (192), Expect = 5e-14 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -3 Query: 122 MGAKLTCCWKPEHNEGSDAYNLEPEDSGESGDLPSFRQYT 3 MGAKLTCCW+PEHN GSD ++LE EDSGESGDLPSFRQYT Sbjct: 1 MGAKLTCCWEPEHNGGSDNHHLEHEDSGESGDLPSFRQYT 40