BLASTX nr result
ID: Angelica27_contig00010414
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00010414 (510 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN00464.1 hypothetical protein DCAR_009218 [Daucus carota subsp... 58 2e-08 >KZN00464.1 hypothetical protein DCAR_009218 [Daucus carota subsp. sativus] Length = 64 Score = 58.2 bits (139), Expect = 2e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +1 Query: 109 MAVVSKTSGLWCKMHKQGDDDDAYTYIIPCVQ 204 MA++SKTSGLWC +HK+GDDDDAYTY +PCV+ Sbjct: 1 MALLSKTSGLWCTVHKEGDDDDAYTY-VPCVR 31