BLASTX nr result
ID: Angelica27_contig00010064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00010064 (317 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249862.1 PREDICTED: 40S ribosomal protein S12-like [Daucus... 83 3e-18 XP_017258830.1 PREDICTED: 40S ribosomal protein S12-like [Daucus... 80 4e-17 KZM91756.1 hypothetical protein DCAR_020879 [Daucus carota subsp... 80 4e-17 XP_017254135.1 PREDICTED: 40S ribosomal protein S12-like isoform... 75 3e-15 XP_002521598.1 PREDICTED: 40S ribosomal protein S12 [Ricinus com... 75 4e-15 XP_015579760.1 PREDICTED: 40S ribosomal protein S12 isoform X2 [... 74 2e-14 XP_002527305.1 PREDICTED: 40S ribosomal protein S12 isoform X1 [... 74 2e-14 KZM93053.1 hypothetical protein DCAR_016298 [Daucus carota subsp... 76 3e-14 XP_020109669.1 40S ribosomal protein S12-like [Ananas comosus] O... 73 3e-14 OAY29433.1 hypothetical protein MANES_15G144400 [Manihot esculenta] 72 5e-14 XP_012072471.1 PREDICTED: 40S ribosomal protein S12-like isoform... 72 5e-14 XP_012067514.1 PREDICTED: 40S ribosomal protein S12 [Jatropha cu... 72 5e-14 XP_012072469.1 PREDICTED: 40S ribosomal protein S12-like isoform... 72 5e-14 KNA23271.1 hypothetical protein SOVF_026510 [Spinacia oleracea] 72 7e-14 XP_002299262.2 hypothetical protein POPTR_0001s14870g [Populus t... 72 7e-14 AQK88738.1 40S ribosomal protein S12 [Zea mays] 71 9e-14 XP_011032755.1 PREDICTED: 40S ribosomal protein S12-like [Populu... 72 1e-13 XP_002306757.1 40S ribosomal protein S12-1 [Populus trichocarpa]... 72 1e-13 ABK96689.1 unknown [Populus trichocarpa x Populus deltoides] 72 1e-13 OEL17637.1 40S ribosomal protein S12, partial [Dichanthelium oli... 71 1e-13 >XP_017249862.1 PREDICTED: 40S ribosomal protein S12-like [Daucus carota subsp. sativus] XP_017249863.1 PREDICTED: 40S ribosomal protein S12-like [Daucus carota subsp. sativus] KZM96138.1 hypothetical protein DCAR_019380 [Daucus carota subsp. sativus] Length = 142 Score = 83.2 bits (204), Expect = 3e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEGNA KVVGCSCVVVKDYGEESEGLNTVQAHVKAN Sbjct: 102 LCKIDSEGNARKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 142 >XP_017258830.1 PREDICTED: 40S ribosomal protein S12-like [Daucus carota subsp. sativus] Length = 143 Score = 80.5 bits (197), Expect = 4e-17 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEGNA KVVGCSCVVVKD+GEESEGLNTVQAHVK+N Sbjct: 103 LCKIDSEGNARKVVGCSCVVVKDFGEESEGLNTVQAHVKSN 143 >KZM91756.1 hypothetical protein DCAR_020879 [Daucus carota subsp. sativus] Length = 148 Score = 80.5 bits (197), Expect = 4e-17 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEGNA KVVGCSCVVVKD+GEESEGLNTVQAHVK+N Sbjct: 108 LCKIDSEGNARKVVGCSCVVVKDFGEESEGLNTVQAHVKSN 148 >XP_017254135.1 PREDICTED: 40S ribosomal protein S12-like isoform X1 [Daucus carota subsp. sativus] XP_017254136.1 PREDICTED: 40S ribosomal protein S12-like isoform X2 [Daucus carota subsp. sativus] XP_017254137.1 PREDICTED: 40S ribosomal protein S12-like isoform X1 [Daucus carota subsp. sativus] Length = 145 Score = 75.5 bits (184), Expect = 3e-15 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKA 141 LCK+DSEGNA KVVGCSCVVVKDYGEESEGL+ V+AHVKA Sbjct: 105 LCKIDSEGNARKVVGCSCVVVKDYGEESEGLDVVRAHVKA 144 >XP_002521598.1 PREDICTED: 40S ribosomal protein S12 [Ricinus communis] EEF40869.1 40S ribosomal protein S12, putative [Ricinus communis] Length = 146 Score = 75.5 bits (184), Expect = 4e-15 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKDYGEESEGLN VQ H+K+N Sbjct: 106 LCKIDSEGKARKVVGCSCVVVKDYGEESEGLNVVQQHIKSN 146 >XP_015579760.1 PREDICTED: 40S ribosomal protein S12 isoform X2 [Ricinus communis] Length = 142 Score = 73.6 bits (179), Expect = 2e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKDYGEESEGLN VQ H+K++ Sbjct: 102 LCKIDSEGKARKVVGCSCVVVKDYGEESEGLNVVQQHIKSH 142 >XP_002527305.1 PREDICTED: 40S ribosomal protein S12 isoform X1 [Ricinus communis] EEF35057.1 40S ribosomal protein S12, putative [Ricinus communis] Length = 145 Score = 73.6 bits (179), Expect = 2e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKDYGEESEGLN VQ H+K++ Sbjct: 105 LCKIDSEGKARKVVGCSCVVVKDYGEESEGLNVVQQHIKSH 145 >KZM93053.1 hypothetical protein DCAR_016298 [Daucus carota subsp. sativus] Length = 309 Score = 75.9 bits (185), Expect = 3e-14 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEGNA KVVGCSCVVVKDYGEESEGL+ V+AHVKA+ Sbjct: 105 LCKIDSEGNARKVVGCSCVVVKDYGEESEGLDVVRAHVKAD 145 Score = 75.5 bits (184), Expect = 5e-14 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKA 141 LCK+DSEGNA KVVGCSCVVVKDYGEESEGL+ V+AHVKA Sbjct: 269 LCKIDSEGNARKVVGCSCVVVKDYGEESEGLDVVRAHVKA 308 >XP_020109669.1 40S ribosomal protein S12-like [Ananas comosus] OAY71507.1 40S ribosomal protein S12 [Ananas comosus] Length = 140 Score = 72.8 bits (177), Expect = 3e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKDYGEESEGLN VQ +VKA+ Sbjct: 100 LCKIDSEGKARKVVGCSCVVVKDYGEESEGLNVVQEYVKAH 140 >OAY29433.1 hypothetical protein MANES_15G144400 [Manihot esculenta] Length = 139 Score = 72.4 bits (176), Expect = 5e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVV+DYGEESEGLN VQ HVK++ Sbjct: 99 LCKIDSEGKARKVVGCSCVVVQDYGEESEGLNVVQQHVKSH 139 >XP_012072471.1 PREDICTED: 40S ribosomal protein S12-like isoform X2 [Jatropha curcas] Length = 140 Score = 72.4 bits (176), Expect = 5e-14 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKDYGEE+EGLN VQ H+K++ Sbjct: 100 LCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQQHIKSH 140 >XP_012067514.1 PREDICTED: 40S ribosomal protein S12 [Jatropha curcas] KDP41982.1 hypothetical protein JCGZ_27000 [Jatropha curcas] Length = 140 Score = 72.4 bits (176), Expect = 5e-14 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKDYGEE+EGLN VQ H+K++ Sbjct: 100 LCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQQHIKSH 140 >XP_012072469.1 PREDICTED: 40S ribosomal protein S12-like isoform X1 [Jatropha curcas] KDP38254.1 hypothetical protein JCGZ_04897 [Jatropha curcas] Length = 140 Score = 72.4 bits (176), Expect = 5e-14 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKDYGEE+EGLN VQ H+K++ Sbjct: 100 LCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQQHIKSH 140 >KNA23271.1 hypothetical protein SOVF_026510 [Spinacia oleracea] Length = 143 Score = 72.0 bits (175), Expect = 7e-14 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKD+GEESEGLN VQ H+K++ Sbjct: 103 LCKIDSEGKARKVVGCSCVVVKDFGEESEGLNVVQQHIKSH 143 >XP_002299262.2 hypothetical protein POPTR_0001s14870g [Populus trichocarpa] ABK93033.1 unknown [Populus trichocarpa] ABK94127.1 unknown [Populus trichocarpa] ABK94279.1 unknown [Populus trichocarpa] EEE84067.2 hypothetical protein POPTR_0001s14870g [Populus trichocarpa] Length = 143 Score = 72.0 bits (175), Expect = 7e-14 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEGNA KVVGCSCVVVKDYGE SEG N VQ HVK++ Sbjct: 103 LCKIDSEGNARKVVGCSCVVVKDYGETSEGYNVVQEHVKSH 143 >AQK88738.1 40S ribosomal protein S12 [Zea mays] Length = 120 Score = 71.2 bits (173), Expect = 9e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKDYGEESEGLN VQ +VK++ Sbjct: 80 LCKIDSEGKARKVVGCSCVVVKDYGEESEGLNIVQEYVKSH 120 >XP_011032755.1 PREDICTED: 40S ribosomal protein S12-like [Populus euphratica] Length = 144 Score = 71.6 bits (174), Expect = 1e-13 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKD+GE+SE LN VQ H+KAN Sbjct: 104 LCKIDSEGKARKVVGCSCVVVKDFGEDSEALNVVQQHIKAN 144 >XP_002306757.1 40S ribosomal protein S12-1 [Populus trichocarpa] ABK94375.1 unknown [Populus trichocarpa] EEE93753.1 40S ribosomal protein S12-1 [Populus trichocarpa] Length = 146 Score = 71.6 bits (174), Expect = 1e-13 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKD+GE+SE LN VQ H+KAN Sbjct: 106 LCKIDSEGKARKVVGCSCVVVKDFGEDSEALNVVQQHIKAN 146 >ABK96689.1 unknown [Populus trichocarpa x Populus deltoides] Length = 148 Score = 71.6 bits (174), Expect = 1e-13 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKD+GE+SE LN VQ H+KAN Sbjct: 108 LCKIDSEGKARKVVGCSCVVVKDFGEDSEALNVVQQHIKAN 148 >OEL17637.1 40S ribosomal protein S12, partial [Dichanthelium oligosanthes] Length = 139 Score = 71.2 bits (173), Expect = 1e-13 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 22 LCKMDSEGNAWKVVGCSCVVVKDYGEESEGLNTVQAHVKAN 144 LCK+DSEG A KVVGCSCVVVKDYGEESEGLN VQ +VK++ Sbjct: 99 LCKIDSEGKARKVVGCSCVVVKDYGEESEGLNIVQEYVKSH 139