BLASTX nr result
ID: Angelica27_contig00009889
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00009889 (220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017238420.1 PREDICTED: probable histone acetyltransferase HAC... 74 9e-14 XP_017238419.1 PREDICTED: probable histone acetyltransferase HAC... 74 9e-14 KZN02221.1 hypothetical protein DCAR_010975 [Daucus carota subsp... 74 9e-14 >XP_017238420.1 PREDICTED: probable histone acetyltransferase HAC-like 1 isoform X2 [Daucus carota subsp. sativus] Length = 1265 Score = 73.9 bits (180), Expect = 9e-14 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 3 WMNDMVLDGRQQVYSNFDASEEEYRNLECLPPGRLKDLL 119 WMNDMVLD R QV+SN DA EEEYRNLECLPPGRLKDLL Sbjct: 27 WMNDMVLDTRPQVHSNVDAFEEEYRNLECLPPGRLKDLL 65 >XP_017238419.1 PREDICTED: probable histone acetyltransferase HAC-like 1 isoform X1 [Daucus carota subsp. sativus] Length = 1298 Score = 73.9 bits (180), Expect = 9e-14 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 3 WMNDMVLDGRQQVYSNFDASEEEYRNLECLPPGRLKDLL 119 WMNDMVLD R QV+SN DA EEEYRNLECLPPGRLKDLL Sbjct: 27 WMNDMVLDTRPQVHSNVDAFEEEYRNLECLPPGRLKDLL 65 >KZN02221.1 hypothetical protein DCAR_010975 [Daucus carota subsp. sativus] Length = 1517 Score = 73.9 bits (180), Expect = 9e-14 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 3 WMNDMVLDGRQQVYSNFDASEEEYRNLECLPPGRLKDLL 119 WMNDMVLD R QV+SN DA EEEYRNLECLPPGRLKDLL Sbjct: 27 WMNDMVLDTRPQVHSNVDAFEEEYRNLECLPPGRLKDLL 65