BLASTX nr result
ID: Angelica27_contig00009631
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00009631 (629 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017214781.1 PREDICTED: putative glycine-rich cell wall struct... 83 1e-16 >XP_017214781.1 PREDICTED: putative glycine-rich cell wall structural protein 1 [Daucus carota subsp. sativus] Length = 139 Score = 82.8 bits (203), Expect = 1e-16 Identities = 41/59 (69%), Positives = 43/59 (72%) Frame = -3 Query: 591 MERKILFATSLIVLIXXXXXXXXXXXXXSGGRKMGAPEKSGTVTEGGTGSAHGPNWEYN 415 MERK L+ TSL+VLI SGGRKMGAPEKSGT TEGGTGSAHGPNWEYN Sbjct: 1 MERKKLYITSLVVLIFVFTYSTAFSTTGSGGRKMGAPEKSGTATEGGTGSAHGPNWEYN 59