BLASTX nr result
ID: Angelica27_contig00009432
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00009432 (211 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017221964.1 PREDICTED: uncharacterized protein At4g14450, chl... 69 2e-13 XP_011091177.1 PREDICTED: uncharacterized protein At4g14450, chl... 51 1e-06 >XP_017221964.1 PREDICTED: uncharacterized protein At4g14450, chloroplastic-like [Daucus carota subsp. sativus] KZM85285.1 hypothetical protein DCAR_027293 [Daucus carota subsp. sativus] KZM85286.1 hypothetical protein DCAR_027292 [Daucus carota subsp. sativus] Length = 111 Score = 68.6 bits (166), Expect = 2e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 55 MSDTSAKISGNRRLSSRLQKRAPASIKISPAPEWNVAI 168 MSDTS K SGNRRLSSRLQKRAPASIKISPA +WNVAI Sbjct: 1 MSDTSVKSSGNRRLSSRLQKRAPASIKISPATDWNVAI 38 >XP_011091177.1 PREDICTED: uncharacterized protein At4g14450, chloroplastic-like [Sesamum indicum] Length = 106 Score = 51.2 bits (121), Expect = 1e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +1 Query: 55 MSDTSAKISGNRRLSSRLQKRAPASIKISPAPEWNVAI 168 M+D + G+RR S+RLQ+RAPASI+ISP EWNVAI Sbjct: 1 MADVGNRRPGSRRQSTRLQRRAPASIQISPVTEWNVAI 38