BLASTX nr result
ID: Angelica27_contig00009381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00009381 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM89223.1 hypothetical protein DCAR_026298 [Daucus carota subsp... 65 8e-10 XP_017218243.1 PREDICTED: pleiotropic drug resistance protein 1-... 65 8e-10 KZN06706.1 hypothetical protein DCAR_007543 [Daucus carota subsp... 61 2e-08 XP_017233844.1 PREDICTED: pleiotropic drug resistance protein 1-... 61 2e-08 KZM89222.1 hypothetical protein DCAR_026297 [Daucus carota subsp... 60 5e-08 KZN06707.1 hypothetical protein DCAR_007544 [Daucus carota subsp... 60 5e-08 XP_017233846.1 PREDICTED: pleiotropic drug resistance protein 1-... 60 5e-08 XP_017215736.1 PREDICTED: pleiotropic drug resistance protein 1-... 60 5e-08 KZN06708.1 hypothetical protein DCAR_007545 [Daucus carota subsp... 56 1e-06 XP_017233841.1 PREDICTED: pleiotropic drug resistance protein 1-... 56 1e-06 XP_017233840.1 PREDICTED: pleiotropic drug resistance protein 1-... 56 1e-06 KZN06710.1 hypothetical protein DCAR_007547 [Daucus carota subsp... 55 2e-06 XP_017234869.1 PREDICTED: pleiotropic drug resistance protein 1-... 55 2e-06 EPS67630.1 hypothetical protein M569_07145, partial [Genlisea au... 54 4e-06 >KZM89223.1 hypothetical protein DCAR_026298 [Daucus carota subsp. sativus] Length = 962 Score = 64.7 bits (156), Expect = 8e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 340 HDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 HD+VWAVALATAGFAI FG FAYSIKAFNFQRR Sbjct: 929 HDSVWAVALATAGFAIAFGAIFAYSIKAFNFQRR 962 >XP_017218243.1 PREDICTED: pleiotropic drug resistance protein 1-like [Daucus carota subsp. sativus] Length = 1439 Score = 64.7 bits (156), Expect = 8e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 340 HDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 HD+VWAVALATAGFAI FG FAYSIKAFNFQRR Sbjct: 1406 HDSVWAVALATAGFAIAFGAIFAYSIKAFNFQRR 1439 >KZN06706.1 hypothetical protein DCAR_007543 [Daucus carota subsp. sativus] Length = 995 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 343 EHDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 EHDNVWAVALA GF +LF TFA+SIK+FNFQRR Sbjct: 961 EHDNVWAVALAVVGFTLLFAVTFAFSIKSFNFQRR 995 >XP_017233844.1 PREDICTED: pleiotropic drug resistance protein 1-like [Daucus carota subsp. sativus] Length = 1427 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 343 EHDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 EHDNVWAVALA GF +LF TFA+SIK+FNFQRR Sbjct: 1393 EHDNVWAVALAVVGFTLLFAVTFAFSIKSFNFQRR 1427 >KZM89222.1 hypothetical protein DCAR_026297 [Daucus carota subsp. sativus] Length = 798 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -2 Query: 343 EHDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 EHDNVWAV LA GFA+LF TFAYSIK FNFQ+R Sbjct: 764 EHDNVWAVGLAVVGFALLFTITFAYSIKTFNFQKR 798 >KZN06707.1 hypothetical protein DCAR_007544 [Daucus carota subsp. sativus] Length = 1264 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 340 HDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 HD VWAVALA GFA+LF TFA+SIKAFNFQRR Sbjct: 1231 HDKVWAVALAVVGFAVLFAFTFAFSIKAFNFQRR 1264 >XP_017233846.1 PREDICTED: pleiotropic drug resistance protein 1-like [Daucus carota subsp. sativus] Length = 1425 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 340 HDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 HD VWAVALA GFA+LF TFA+SIKAFNFQRR Sbjct: 1392 HDKVWAVALAVVGFAVLFAFTFAFSIKAFNFQRR 1425 >XP_017215736.1 PREDICTED: pleiotropic drug resistance protein 1-like [Daucus carota subsp. sativus] Length = 1428 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -2 Query: 343 EHDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 EHDNVWAV LA GFA+LF TFAYSIK FNFQ+R Sbjct: 1394 EHDNVWAVGLAVVGFALLFTITFAYSIKTFNFQKR 1428 >KZN06708.1 hypothetical protein DCAR_007545 [Daucus carota subsp. sativus] Length = 937 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 340 HDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 HD VWAVALA GF LF TFA+SI+AFNFQRR Sbjct: 904 HDKVWAVALAVVGFTFLFAFTFAFSIRAFNFQRR 937 >XP_017233841.1 PREDICTED: pleiotropic drug resistance protein 1-like isoform X2 [Daucus carota subsp. sativus] Length = 1431 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 340 HDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 HD VWAVALA GF LF TFA+SI+AFNFQRR Sbjct: 1398 HDKVWAVALAVVGFTFLFAFTFAFSIRAFNFQRR 1431 >XP_017233840.1 PREDICTED: pleiotropic drug resistance protein 1-like isoform X1 [Daucus carota subsp. sativus] Length = 1458 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 340 HDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 HD VWAVALA GF LF TFA+SI+AFNFQRR Sbjct: 1425 HDKVWAVALAVVGFTFLFAFTFAFSIRAFNFQRR 1458 >KZN06710.1 hypothetical protein DCAR_007547 [Daucus carota subsp. sativus] Length = 736 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -2 Query: 343 EHDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 EH NVW A AGF +LF TFAYSIK+FNFQRR Sbjct: 702 EHHNVWVAGAAVAGFTVLFAYTFAYSIKSFNFQRR 736 >XP_017234869.1 PREDICTED: pleiotropic drug resistance protein 1-like [Daucus carota subsp. sativus] Length = 1438 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -2 Query: 343 EHDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 EH NVW A AGF +LF TFAYSIK+FNFQRR Sbjct: 1404 EHHNVWVAGAAVAGFTVLFAYTFAYSIKSFNFQRR 1438 >EPS67630.1 hypothetical protein M569_07145, partial [Genlisea aurea] Length = 391 Score = 53.9 bits (128), Expect = 4e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 343 EHDNVWAVALATAGFAILFGGTFAYSIKAFNFQRR 239 ++D++W VAL GF +LFG TFAYSIKAFNFQ+R Sbjct: 357 KYDHLWYVALIVVGFTVLFGFTFAYSIKAFNFQKR 391