BLASTX nr result
ID: Angelica27_contig00009305
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00009305 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN06533.1 hypothetical protein DCAR_007370 [Daucus carota subsp... 77 3e-16 KRG98272.1 hypothetical protein GLYMA_18G061600 [Glycine max] 52 1e-06 >KZN06533.1 hypothetical protein DCAR_007370 [Daucus carota subsp. sativus] Length = 76 Score = 76.6 bits (187), Expect = 3e-16 Identities = 40/57 (70%), Positives = 42/57 (73%) Frame = -2 Query: 279 ARNTMFLSGEELKVGRSLKMISVNDYGDATANHGHDPXXXXXXXXXXXXGHRTRDIP 109 ARNTMFLSGEE+KVGRSLKMI V+DY DATANHGHDP GHRT DIP Sbjct: 22 ARNTMFLSGEEVKVGRSLKMIGVDDYSDATANHGHDP--RNKPGGGNGNGHRTHDIP 76 >KRG98272.1 hypothetical protein GLYMA_18G061600 [Glycine max] Length = 79 Score = 52.0 bits (123), Expect = 1e-06 Identities = 24/40 (60%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = -2 Query: 282 TARNTMFLSGEELK--VGRSLKMISVNDYGDATANHGHDP 169 TAR+ +F S +E VGRSLK+I++ DYG+ TANHGHDP Sbjct: 26 TARSPIFFSNDEASSMVGRSLKVINLQDYGEPTANHGHDP 65