BLASTX nr result
ID: Angelica27_contig00009085
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00009085 (260 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017225417.1 PREDICTED: probable nucleoredoxin 1 [Daucus carot... 57 2e-07 XP_017225586.1 PREDICTED: probable nucleoredoxin 1 [Daucus carot... 54 2e-06 XP_017225585.1 PREDICTED: probable nucleoredoxin 1 isoform X2 [D... 54 2e-06 KZM83101.1 hypothetical protein DCAR_030670 [Daucus carota subsp... 54 2e-06 XP_017225584.1 PREDICTED: probable nucleoredoxin 1 isoform X1 [D... 54 2e-06 >XP_017225417.1 PREDICTED: probable nucleoredoxin 1 [Daucus carota subsp. sativus] Length = 538 Score = 56.6 bits (135), Expect = 2e-07 Identities = 36/80 (45%), Positives = 47/80 (58%), Gaps = 4/80 (5%) Frame = -1 Query: 239 QLTG--ESPSSIYHGAANKAKHRYYCDLSIPSTTFKYAKYGKEV--EKELTSISEGDIVN 72 QL G E S Y+ K K D+++ + T + K+ +KELTS+S GDIVN Sbjct: 46 QLDGFTEDHRSTYYKLEKKTKKESDFDIAVRNFTNLSIEMKKQNINQKELTSVSSGDIVN 105 Query: 71 LSELLFTKSRDYLIRCNNGQ 12 L ELLFTK+RDYLI+ N Q Sbjct: 106 LHELLFTKNRDYLIKFNGDQ 125 >XP_017225586.1 PREDICTED: probable nucleoredoxin 1 [Daucus carota subsp. sativus] Length = 490 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 113 EKELTSISEGDIVNLSELLFTKSRDYLIRCNNGQ 12 +KELTS+S GDIVNL ELLFTK+RDYLI+ N Q Sbjct: 92 QKELTSVSSGDIVNLHELLFTKNRDYLIKFNGDQ 125 >XP_017225585.1 PREDICTED: probable nucleoredoxin 1 isoform X2 [Daucus carota subsp. sativus] Length = 563 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 113 EKELTSISEGDIVNLSELLFTKSRDYLIRCNNGQ 12 +KELTS+S GDIVNL ELLFTK+RDYLI+ N Q Sbjct: 8 QKELTSVSSGDIVNLHELLFTKNRDYLIKFNGDQ 41 >KZM83101.1 hypothetical protein DCAR_030670 [Daucus carota subsp. sativus] Length = 566 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 113 EKELTSISEGDIVNLSELLFTKSRDYLIRCNNGQ 12 +KELTS+S GDIVNL ELLFTK+RDYLI+ N Q Sbjct: 8 QKELTSVSSGDIVNLHELLFTKNRDYLIKFNGDQ 41 >XP_017225584.1 PREDICTED: probable nucleoredoxin 1 isoform X1 [Daucus carota subsp. sativus] Length = 647 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 113 EKELTSISEGDIVNLSELLFTKSRDYLIRCNNGQ 12 +KELTS+S GDIVNL ELLFTK+RDYLI+ N Q Sbjct: 92 QKELTSVSSGDIVNLHELLFTKNRDYLIKFNGDQ 125