BLASTX nr result
ID: Angelica27_contig00009021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00009021 (2131 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM81637.1 hypothetical protein DCAR_029250 [Daucus carota subsp... 61 1e-06 >KZM81637.1 hypothetical protein DCAR_029250 [Daucus carota subsp. sativus] Length = 260 Score = 61.2 bits (147), Expect = 1e-06 Identities = 37/75 (49%), Positives = 39/75 (52%) Frame = -2 Query: 279 HAVCGSCCNSVLLLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQRSTSASLSPI 100 HAVCGSC +S+LLLY RQRS S SLSPI Sbjct: 11 HAVCGSCSDSLLLLYRRKSRSISPRRRKSRSPTPRRRRSRSATPRRYKRQRSISTSLSPI 70 Query: 99 KRSPSTGSLELKNVT 55 KRSPSTGSLELKNVT Sbjct: 71 KRSPSTGSLELKNVT 85