BLASTX nr result
ID: Angelica27_contig00009016
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00009016 (445 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017225876.1 PREDICTED: LYR motif-containing protein At3g19508... 158 8e-48 KZM81478.1 hypothetical protein DCAR_029091 [Daucus carota subsp... 152 9e-46 XP_012836784.1 PREDICTED: LYR motif-containing protein At3g19508... 135 1e-38 XP_004230727.1 PREDICTED: LYR motif-containing protein At3g19508... 133 6e-38 XP_006346350.1 PREDICTED: LYR motif-containing protein At3g19508... 132 9e-38 XP_015084166.1 PREDICTED: LYR motif-containing protein At3g19508... 131 2e-37 XP_016539488.1 PREDICTED: LYR motif-containing protein At3g19508... 130 5e-37 XP_019225860.1 PREDICTED: LYR motif-containing protein At3g19508... 129 1e-36 XP_004511298.1 PREDICTED: LYR motif-containing protein At3g19508... 129 2e-36 XP_011088199.1 PREDICTED: LYR motif-containing protein At3g19508... 129 2e-36 XP_010691653.1 PREDICTED: LYR motif-containing protein At3g19508... 127 9e-36 XP_002268939.2 PREDICTED: LYR motif-containing protein At3g19508... 127 1e-35 KMT01114.1 hypothetical protein BVRB_9g223660 [Beta vulgaris sub... 127 1e-35 XP_012092964.1 PREDICTED: LYR motif-containing protein At3g19508... 126 2e-35 XP_013453298.1 UPF0631 plant-like protein [Medicago truncatula] ... 126 2e-35 GAU29522.1 hypothetical protein TSUD_115440 [Trifolium subterran... 126 3e-35 XP_009610038.1 PREDICTED: LYR motif-containing protein At3g19508... 127 3e-35 XP_016197040.1 PREDICTED: LYR motif-containing protein At3g19508... 126 9e-35 XP_016465348.1 PREDICTED: LYR motif-containing protein At3g19508... 125 9e-35 XP_015892821.1 PREDICTED: LYR motif-containing protein At3g19508... 124 2e-34 >XP_017225876.1 PREDICTED: LYR motif-containing protein At3g19508 [Daucus carota subsp. sativus] Length = 87 Score = 158 bits (399), Expect = 8e-48 Identities = 78/85 (91%), Positives = 80/85 (94%) Frame = -3 Query: 443 QSKMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYK 264 QSKMK+VISAYGEVLRLVRRLPEDSR YYAKYARENFVNYREVDPNDA ALQELL+RTY Sbjct: 3 QSKMKKVISAYGEVLRLVRRLPEDSRPYYAKYARENFVNYREVDPNDANALQELLARTYN 62 Query: 263 HSLWVLKKYSVEEAAADKLKNICCN 189 HSLWVL KYSVEEAAA KLKNICCN Sbjct: 63 HSLWVLSKYSVEEAAAAKLKNICCN 87 >KZM81478.1 hypothetical protein DCAR_029091 [Daucus carota subsp. sativus] Length = 82 Score = 152 bits (385), Expect = 9e-46 Identities = 75/82 (91%), Positives = 77/82 (93%) Frame = -3 Query: 434 MKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHSL 255 MK+VISAYGEVLRLVRRLPEDSR YYAKYARENFVNYREVDPNDA ALQELL+RTY HSL Sbjct: 1 MKKVISAYGEVLRLVRRLPEDSRPYYAKYARENFVNYREVDPNDANALQELLARTYNHSL 60 Query: 254 WVLKKYSVEEAAADKLKNICCN 189 WVL KYSVEEAAA KLKNICCN Sbjct: 61 WVLSKYSVEEAAAAKLKNICCN 82 >XP_012836784.1 PREDICTED: LYR motif-containing protein At3g19508 [Erythranthe guttata] EYU37620.1 hypothetical protein MIMGU_mgv1a017241mg [Erythranthe guttata] Length = 87 Score = 135 bits (339), Expect = 1e-38 Identities = 63/81 (77%), Positives = 74/81 (91%) Frame = -3 Query: 437 KMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHS 258 +M++V+ AYGEVLRLVRRLPEDSR YYAKYARENFVNYREVDP D+ A++ELL+RTYKHS Sbjct: 5 EMQKVLRAYGEVLRLVRRLPEDSRPYYAKYARENFVNYREVDPGDSAAVEELLARTYKHS 64 Query: 257 LWVLKKYSVEEAAADKLKNIC 195 LW+L KYSV+E+AA KLK IC Sbjct: 65 LWILNKYSVDESAAGKLKEIC 85 >XP_004230727.1 PREDICTED: LYR motif-containing protein At3g19508 [Solanum lycopersicum] Length = 87 Score = 133 bits (334), Expect = 6e-38 Identities = 63/83 (75%), Positives = 73/83 (87%) Frame = -3 Query: 437 KMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHS 258 +M++ I AY EVLRLVRRLP+DSR YYAKYARENFVNYRE+D ND ALQELL RTY HS Sbjct: 5 EMQKAIGAYREVLRLVRRLPKDSRPYYAKYARENFVNYREIDSNDPNALQELLQRTYNHS 64 Query: 257 LWVLKKYSVEEAAADKLKNICCN 189 LWVLKKYSV+++AAD+LKNIC + Sbjct: 65 LWVLKKYSVDQSAADRLKNICAD 87 >XP_006346350.1 PREDICTED: LYR motif-containing protein At3g19508 [Solanum tuberosum] Length = 87 Score = 132 bits (333), Expect = 9e-38 Identities = 63/81 (77%), Positives = 72/81 (88%) Frame = -3 Query: 437 KMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHS 258 +M++ I AY EVLRLVRRLP+DSR YYAKYARENFVNYRE+D ND ALQELL RTY HS Sbjct: 5 EMQKAIGAYREVLRLVRRLPKDSRPYYAKYARENFVNYREIDSNDPNALQELLQRTYNHS 64 Query: 257 LWVLKKYSVEEAAADKLKNIC 195 LWVLKKYSV+++AAD+LKNIC Sbjct: 65 LWVLKKYSVDQSAADRLKNIC 85 >XP_015084166.1 PREDICTED: LYR motif-containing protein At3g19508 [Solanum pennellii] Length = 87 Score = 131 bits (330), Expect = 2e-37 Identities = 62/81 (76%), Positives = 72/81 (88%) Frame = -3 Query: 437 KMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHS 258 +M++ I AY EVLRLVRRLP+DSR YYAKYARENFVNYRE+D ND ALQELL RTY HS Sbjct: 5 EMQKAIGAYREVLRLVRRLPKDSRPYYAKYARENFVNYREIDSNDPNALQELLQRTYNHS 64 Query: 257 LWVLKKYSVEEAAADKLKNIC 195 LWVLKKYSV+++AAD+L+NIC Sbjct: 65 LWVLKKYSVDQSAADRLRNIC 85 >XP_016539488.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Capsicum annuum] XP_016539489.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Capsicum annuum] XP_016539490.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Capsicum annuum] XP_016539491.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Capsicum annuum] Length = 87 Score = 130 bits (328), Expect = 5e-37 Identities = 61/81 (75%), Positives = 72/81 (88%) Frame = -3 Query: 437 KMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHS 258 +M++ I AY EVLRLVRRLP+D+R YYAKYARENFVNYRE+D ND ALQELL RTY HS Sbjct: 5 EMQKAIGAYREVLRLVRRLPKDTRPYYAKYARENFVNYREIDSNDPNALQELLQRTYNHS 64 Query: 257 LWVLKKYSVEEAAADKLKNIC 195 +WVLKKYSV+++AAD+LKNIC Sbjct: 65 IWVLKKYSVDQSAADRLKNIC 85 >XP_019225860.1 PREDICTED: LYR motif-containing protein At3g19508 [Nicotiana attenuata] OIT32390.1 lyr motif-containing protein [Nicotiana attenuata] Length = 87 Score = 129 bits (325), Expect = 1e-36 Identities = 61/81 (75%), Positives = 71/81 (87%) Frame = -3 Query: 437 KMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHS 258 +MK+ I AY EVLRLVRRLP+D++ YYAKYARENFVNYRE+D ND ALQELL RTY HS Sbjct: 5 EMKKAIGAYREVLRLVRRLPKDTQPYYAKYARENFVNYREIDSNDPNALQELLQRTYNHS 64 Query: 257 LWVLKKYSVEEAAADKLKNIC 195 LWVL KYSV+++AAD+LKNIC Sbjct: 65 LWVLNKYSVDQSAADRLKNIC 85 >XP_004511298.1 PREDICTED: LYR motif-containing protein At3g19508 [Cicer arietinum] Length = 82 Score = 129 bits (324), Expect = 2e-36 Identities = 60/81 (74%), Positives = 69/81 (85%) Frame = -3 Query: 434 MKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHSL 255 M++ + AY EVLRLVRRLP+DSR YYAKYARENFVNYREVDP+D+ L +L RTY HSL Sbjct: 1 MEKAVRAYAEVLRLVRRLPKDSRGYYAKYARENFVNYREVDPSDSSTLHDLFQRTYTHSL 60 Query: 254 WVLKKYSVEEAAADKLKNICC 192 WVL KYSV+E+AADKLK ICC Sbjct: 61 WVLHKYSVDESAADKLKGICC 81 >XP_011088199.1 PREDICTED: LYR motif-containing protein At3g19508 [Sesamum indicum] Length = 87 Score = 129 bits (324), Expect = 2e-36 Identities = 60/81 (74%), Positives = 70/81 (86%) Frame = -3 Query: 437 KMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHS 258 +M + + AYGEVLRLVRRLP+D+R YYAKYARENFVNYR+VDPNDA AL ELL+RTY HS Sbjct: 5 EMHKALRAYGEVLRLVRRLPQDTRAYYAKYARENFVNYRDVDPNDAAALNELLNRTYTHS 64 Query: 257 LWVLKKYSVEEAAADKLKNIC 195 LWVL KYS++E+ A KLK IC Sbjct: 65 LWVLNKYSLDESVAGKLKEIC 85 >XP_010691653.1 PREDICTED: LYR motif-containing protein At3g19508 [Beta vulgaris subsp. vulgaris] XP_019107066.1 PREDICTED: LYR motif-containing protein At3g19508 [Beta vulgaris subsp. vulgaris] Length = 89 Score = 127 bits (320), Expect = 9e-36 Identities = 57/83 (68%), Positives = 72/83 (86%) Frame = -3 Query: 440 SKMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKH 261 ++M++ + AY EVLRL+RRLP+D+R YYAKYARENFVNYREVD D A+ ELL+RTY H Sbjct: 5 AQMQKTLRAYAEVLRLIRRLPKDTRSYYAKYARENFVNYREVDATDTAAIDELLNRTYTH 64 Query: 260 SLWVLKKYSVEEAAADKLKNICC 192 SLWVL+KYSV++AAA+KLK +CC Sbjct: 65 SLWVLQKYSVDDAAAEKLKRVCC 87 >XP_002268939.2 PREDICTED: LYR motif-containing protein At3g19508 [Vitis vinifera] XP_010647957.1 PREDICTED: LYR motif-containing protein At3g19508 [Vitis vinifera] CBI22511.3 unnamed protein product, partial [Vitis vinifera] Length = 82 Score = 127 bits (319), Expect = 1e-35 Identities = 60/82 (73%), Positives = 69/82 (84%) Frame = -3 Query: 434 MKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHSL 255 MK+ + AYG VLRLVRRLP+D+R YYAKYARENFVNYREVD D AL +L +RTY HSL Sbjct: 1 MKKALKAYGAVLRLVRRLPKDTRPYYAKYARENFVNYREVDAADPNALNDLFNRTYTHSL 60 Query: 254 WVLKKYSVEEAAADKLKNICCN 189 WVL KYSV++AAADKLK ICC+ Sbjct: 61 WVLNKYSVDQAAADKLKEICCS 82 >KMT01114.1 hypothetical protein BVRB_9g223660 [Beta vulgaris subsp. vulgaris] Length = 83 Score = 127 bits (318), Expect = 1e-35 Identities = 57/81 (70%), Positives = 70/81 (86%) Frame = -3 Query: 434 MKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHSL 255 M++ + AY EVLRL+RRLP+D+R YYAKYARENFVNYREVD D A+ ELL+RTY HSL Sbjct: 1 MQKTLRAYAEVLRLIRRLPKDTRSYYAKYARENFVNYREVDATDTAAIDELLNRTYTHSL 60 Query: 254 WVLKKYSVEEAAADKLKNICC 192 WVL+KYSV++AAA+KLK +CC Sbjct: 61 WVLQKYSVDDAAAEKLKRVCC 81 >XP_012092964.1 PREDICTED: LYR motif-containing protein At3g19508 [Jatropha curcas] XP_012092973.1 PREDICTED: LYR motif-containing protein At3g19508 [Jatropha curcas] XP_012092982.1 PREDICTED: LYR motif-containing protein At3g19508 [Jatropha curcas] KDP44433.1 hypothetical protein JCGZ_16266 [Jatropha curcas] Length = 82 Score = 126 bits (317), Expect = 2e-35 Identities = 59/81 (72%), Positives = 67/81 (82%) Frame = -3 Query: 434 MKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHSL 255 M++ + YGEVLRLVRRLPEDSR YYAKYARENFVNYREVD ND AL EL R Y HS+ Sbjct: 1 MQKALKVYGEVLRLVRRLPEDSRPYYAKYARENFVNYREVDANDTNALDELFLRAYNHSV 60 Query: 254 WVLKKYSVEEAAADKLKNICC 192 WVL KYSV+E+AA++LK ICC Sbjct: 61 WVLNKYSVDESAANRLKEICC 81 >XP_013453298.1 UPF0631 plant-like protein [Medicago truncatula] KEH27327.1 UPF0631 plant-like protein [Medicago truncatula] Length = 83 Score = 126 bits (317), Expect = 2e-35 Identities = 59/81 (72%), Positives = 68/81 (83%) Frame = -3 Query: 434 MKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHSL 255 M++ + AY EVLRLVRRLP+DSR YYAKYARENFVNYREVDP+D+ L +L RTY HSL Sbjct: 1 MEKAVRAYAEVLRLVRRLPKDSRGYYAKYARENFVNYREVDPSDSTTLHDLFQRTYTHSL 60 Query: 254 WVLKKYSVEEAAADKLKNICC 192 WVL KYSV+E+ ADKLK ICC Sbjct: 61 WVLHKYSVDESVADKLKVICC 81 >GAU29522.1 hypothetical protein TSUD_115440 [Trifolium subterraneum] Length = 82 Score = 126 bits (316), Expect = 3e-35 Identities = 58/81 (71%), Positives = 68/81 (83%) Frame = -3 Query: 434 MKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHSL 255 M++ + AY EVLRLVRRLP+DSR YYAKYARENFVNYREVDP+D+ L +L RTY HSL Sbjct: 1 MEKAVRAYAEVLRLVRRLPKDSRGYYAKYARENFVNYREVDPSDSTTLHDLFQRTYTHSL 60 Query: 254 WVLKKYSVEEAAADKLKNICC 192 WVL KYS++ +AADKLK ICC Sbjct: 61 WVLHKYSIDGSAADKLKGICC 81 >XP_009610038.1 PREDICTED: LYR motif-containing protein At3g19508 [Nicotiana tomentosiformis] XP_016492121.1 PREDICTED: LYR motif-containing protein At3g19508-like [Nicotiana tabacum] Length = 108 Score = 127 bits (318), Expect = 3e-35 Identities = 60/81 (74%), Positives = 69/81 (85%) Frame = -3 Query: 437 KMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHS 258 +MK+ I AY EVLRLVR LP+D+R YYAKY RENFVNYRE+D ND ALQELL RTY HS Sbjct: 26 EMKKAIGAYREVLRLVRLLPKDTRPYYAKYVRENFVNYREIDSNDPNALQELLQRTYNHS 85 Query: 257 LWVLKKYSVEEAAADKLKNIC 195 LWVL KYSV+++AAD+LKNIC Sbjct: 86 LWVLNKYSVDQSAADRLKNIC 106 >XP_016197040.1 PREDICTED: LYR motif-containing protein At3g19508 isoform X2 [Arachis ipaensis] Length = 121 Score = 126 bits (316), Expect = 9e-35 Identities = 60/98 (61%), Positives = 76/98 (77%), Gaps = 1/98 (1%) Frame = -3 Query: 434 MKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHSL 255 M++ + AY EVLRLVRRLP++SR YYAKYARENFVNYR+VDP+D+ L +L RTY HS+ Sbjct: 1 MEKALRAYAEVLRLVRRLPKESRGYYAKYARENFVNYRDVDPSDSTTLHDLFQRTYNHSI 60 Query: 254 WVLKKYSVEEAAADKLKNICCN*SACQV-FGFMSEWGY 144 W+L KYSV+++AADKLK ICC + + FGF W Y Sbjct: 61 WLLHKYSVDDSAADKLKRICCGPQSLSLSFGF---WSY 95 >XP_016465348.1 PREDICTED: LYR motif-containing protein At3g19508-like [Nicotiana tabacum] Length = 87 Score = 125 bits (313), Expect = 9e-35 Identities = 59/81 (72%), Positives = 69/81 (85%) Frame = -3 Query: 437 KMKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHS 258 +MK+ I AY EVLRLVRRLP+D+R YYAKYARENFVNYRE+D ND ALQELL R Y HS Sbjct: 5 EMKKAIGAYREVLRLVRRLPKDTRPYYAKYARENFVNYREIDSNDPNALQELLQRAYNHS 64 Query: 257 LWVLKKYSVEEAAADKLKNIC 195 +WVL KYSV+++AAD+LK IC Sbjct: 65 IWVLNKYSVDQSAADRLKIIC 85 >XP_015892821.1 PREDICTED: LYR motif-containing protein At3g19508 [Ziziphus jujuba] Length = 82 Score = 124 bits (310), Expect = 2e-34 Identities = 56/82 (68%), Positives = 69/82 (84%) Frame = -3 Query: 434 MKEVISAYGEVLRLVRRLPEDSRIYYAKYARENFVNYREVDPNDAPALQELLSRTYKHSL 255 M++ + YGE+LRLVRRLP+D+R YYAKYARENFVNYREVD ND+ AL+EL R Y HS+ Sbjct: 1 MEKALRIYGEILRLVRRLPKDTRPYYAKYARENFVNYREVDANDSIALEELFHRAYNHSI 60 Query: 254 WVLKKYSVEEAAADKLKNICCN 189 WVL KYSV+++AADKLK +C N Sbjct: 61 WVLNKYSVDQSAADKLKEVCYN 82