BLASTX nr result
ID: Angelica27_contig00008614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00008614 (795 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017254156.1 PREDICTED: glycine-rich RNA-binding protein blt80... 73 1e-13 XP_017232628.1 PREDICTED: cold shock domain-containing protein 4... 72 1e-12 AGN12855.1 putative glycine-rich protein [Leavenworthia alabamica] 64 3e-09 XP_002869876.1 hypothetical protein ARALYDRAFT_914508 [Arabidops... 63 7e-09 XP_018450882.1 PREDICTED: neuropeptide-like protein 31 [Raphanus... 62 1e-08 XP_018449335.1 PREDICTED: glycine-rich cell wall structural prot... 62 1e-08 XP_013625837.1 PREDICTED: glycine, alanine and asparagine-rich p... 62 1e-08 KFK28744.1 hypothetical protein AALP_AA7G041400 [Arabis alpina] 62 1e-08 XP_009108489.1 PREDICTED: ATP-dependent RNA helicase A-like [Bra... 62 2e-08 XP_006413753.1 hypothetical protein EUTSA_v10026556mg [Eutrema s... 62 2e-08 NP_001190788.1 glycine-rich protein [Arabidopsis thaliana] AEE84... 60 2e-08 XP_010449024.1 PREDICTED: neuropeptide-like protein 31 [Camelina... 61 3e-08 XP_006286024.1 hypothetical protein CARUB_v10007555mg [Capsella ... 61 3e-08 OAO99940.1 hypothetical protein AXX17_AT4G25080 [Arabidopsis tha... 60 5e-08 NP_193893.1 glycine-rich protein [Arabidopsis thaliana] AAK28633... 60 5e-08 XP_013599270.1 PREDICTED: neuropeptide-like protein 31 [Brassica... 60 7e-08 XP_010439448.1 PREDICTED: keratin, type II cytoskeletal 5-like [... 60 7e-08 XP_010434152.1 PREDICTED: neuropeptide-like protein 31 [Camelina... 60 7e-08 XP_009137199.1 PREDICTED: ATP-dependent RNA helicase A [Brassica... 60 7e-08 XP_013717248.1 PREDICTED: neuropeptide-like protein 31 [Brassica... 60 7e-08 >XP_017254156.1 PREDICTED: glycine-rich RNA-binding protein blt801 [Daucus carota subsp. sativus] Length = 128 Score = 73.2 bits (178), Expect(2) = 1e-13 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWS S Sbjct: 70 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSHS 101 Score = 31.6 bits (70), Expect(2) = 1e-13 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 292 DCKKKCTASCST 257 DCKKKCTASCST Sbjct: 117 DCKKKCTASCST 128 >XP_017232628.1 PREDICTED: cold shock domain-containing protein 4 [Daucus carota subsp. sativus] KZN07226.1 hypothetical protein DCAR_008063 [Daucus carota subsp. sativus] Length = 147 Score = 72.4 bits (176), Expect(2) = 1e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 419 VRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VRPVVTCKVKGPCYGKKLRCP+KCFTSWSRS Sbjct: 90 VRPVVTCKVKGPCYGKKLRCPAKCFTSWSRS 120 Score = 28.9 bits (63), Expect(2) = 1e-12 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 292 DCKKKCTASCST 257 DCKKKCT +CST Sbjct: 136 DCKKKCTTTCST 147 >AGN12855.1 putative glycine-rich protein [Leavenworthia alabamica] Length = 131 Score = 63.9 bits (154), Expect = 3e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 V+RP VTC+ KGPCYGKKLRCP+KCFTS+SRS Sbjct: 75 VMRPTVTCREKGPCYGKKLRCPAKCFTSFSRS 106 >XP_002869876.1 hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] EFH46135.1 hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] Length = 131 Score = 62.8 bits (151), Expect = 7e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTC+ KGPCYGKKLRCP+KCF S+SRS Sbjct: 75 VVRPTVTCREKGPCYGKKLRCPAKCFKSFSRS 106 >XP_018450882.1 PREDICTED: neuropeptide-like protein 31 [Raphanus sativus] Length = 131 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTC+VKGPC GKKLRCP+KCF+S+SRS Sbjct: 75 VVRPTVTCRVKGPCNGKKLRCPAKCFSSFSRS 106 >XP_018449335.1 PREDICTED: glycine-rich cell wall structural protein 2-like [Raphanus sativus] Length = 131 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTC+VKGPC GKKLRCP+KCF+S+SRS Sbjct: 75 VVRPTVTCRVKGPCNGKKLRCPAKCFSSFSRS 106 >XP_013625837.1 PREDICTED: glycine, alanine and asparagine-rich protein-like [Brassica oleracea var. oleracea] XP_013728441.1 PREDICTED: glycine, alanine and asparagine-rich protein [Brassica napus] CDX76436.1 BnaA08g09640D [Brassica napus] Length = 131 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTC+VKGPC GKKLRCP+KCF+S+SRS Sbjct: 75 VVRPTVTCRVKGPCNGKKLRCPAKCFSSFSRS 106 >KFK28744.1 hypothetical protein AALP_AA7G041400 [Arabis alpina] Length = 133 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 419 VRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VRP VTCKVKGPC GKKLRCP+KCF+S+SRS Sbjct: 78 VRPTVTCKVKGPCNGKKLRCPAKCFSSFSRS 108 >XP_009108489.1 PREDICTED: ATP-dependent RNA helicase A-like [Brassica rapa] Length = 153 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTC+VKGPC GKKLRCP+KCF+S+SRS Sbjct: 97 VVRPTVTCRVKGPCNGKKLRCPAKCFSSFSRS 128 >XP_006413753.1 hypothetical protein EUTSA_v10026556mg [Eutrema salsugineum] ESQ55206.1 hypothetical protein EUTSA_v10026556mg [Eutrema salsugineum] Length = 131 Score = 61.6 bits (148), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTC+ KGPC+GKKLRCP+KCF+S+SRS Sbjct: 75 VVRPTVTCREKGPCHGKKLRCPAKCFSSFSRS 106 >NP_001190788.1 glycine-rich protein [Arabidopsis thaliana] AEE84482.1 glycine-rich protein [Arabidopsis thaliana] Length = 98 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTCK KGPC GKKLRCP+KCF S+SRS Sbjct: 42 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRS 73 >XP_010449024.1 PREDICTED: neuropeptide-like protein 31 [Camelina sativa] Length = 133 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTCK KGPC GKKLRCP+KCF+S+SRS Sbjct: 77 VVRPTVTCKEKGPCNGKKLRCPAKCFSSFSRS 108 >XP_006286024.1 hypothetical protein CARUB_v10007555mg [Capsella rubella] EOA18922.1 hypothetical protein CARUB_v10007555mg [Capsella rubella] Length = 133 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTCK KGPC GKKLRCP+KCF+S+SRS Sbjct: 77 VVRPTVTCKEKGPCNGKKLRCPAKCFSSFSRS 108 >OAO99940.1 hypothetical protein AXX17_AT4G25080 [Arabidopsis thaliana] Length = 131 Score = 60.5 bits (145), Expect = 5e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTCK KGPC GKKLRCP+KCF S+SRS Sbjct: 75 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRS 106 >NP_193893.1 glycine-rich protein [Arabidopsis thaliana] AAK28633.1 unknown protein [Arabidopsis thaliana] CAB36806.1 putative protein [Arabidopsis thaliana] CAB81269.1 putative protein [Arabidopsis thaliana] AAK93748.1 unknown protein [Arabidopsis thaliana] AAL25552.1 AT4g21620/F17L22_80 [Arabidopsis thaliana] AAM62961.1 unknown [Arabidopsis thaliana] BAE99017.1 hypothetical protein [Arabidopsis thaliana] AEE84481.1 glycine-rich protein [Arabidopsis thaliana] Length = 131 Score = 60.5 bits (145), Expect = 5e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTCK KGPC GKKLRCP+KCF S+SRS Sbjct: 75 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRS 106 >XP_013599270.1 PREDICTED: neuropeptide-like protein 31 [Brassica oleracea var. oleracea] Length = 133 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTCK KGPC GKKLRCP++CF+S+SRS Sbjct: 77 VVRPTVTCKEKGPCNGKKLRCPARCFSSFSRS 108 >XP_010439448.1 PREDICTED: keratin, type II cytoskeletal 5-like [Camelina sativa] Length = 133 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTC+ KGPC GKKLRCP+KCF+S+SRS Sbjct: 77 VVRPTVTCREKGPCNGKKLRCPAKCFSSFSRS 108 >XP_010434152.1 PREDICTED: neuropeptide-like protein 31 [Camelina sativa] Length = 133 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTC+ KGPC GKKLRCP+KCF+S+SRS Sbjct: 77 VVRPTVTCREKGPCNGKKLRCPAKCFSSFSRS 108 >XP_009137199.1 PREDICTED: ATP-dependent RNA helicase A [Brassica rapa] Length = 133 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTCK KGPC GKKLRCP++CF+S+SRS Sbjct: 77 VVRPTVTCKEKGPCNGKKLRCPARCFSSFSRS 108 >XP_013717248.1 PREDICTED: neuropeptide-like protein 31 [Brassica napus] CDX94042.1 BnaC07g36760D [Brassica napus] Length = 133 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 422 VVRPVVTCKVKGPCYGKKLRCPSKCFTSWSRS 327 VVRP VTCK KGPC GKKLRCP++CF+S+SRS Sbjct: 77 VVRPTVTCKEKGPCNGKKLRCPARCFSSFSRS 108