BLASTX nr result
ID: Angelica27_contig00008446
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00008446 (685 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017253022.1 PREDICTED: splicing factor U2af large subunit A i... 69 8e-10 KZM94000.1 hypothetical protein DCAR_017245 [Daucus carota subsp... 69 8e-10 XP_017253021.1 PREDICTED: splicing factor U2af large subunit A i... 69 8e-10 >XP_017253022.1 PREDICTED: splicing factor U2af large subunit A isoform X2 [Daucus carota subsp. sativus] Length = 578 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = -1 Query: 559 MSDYEGEADEFNNN--GSPLLAKPNNNGAALDSDSKSQRGS 443 MSDYEGE DE NNN GSPLL K NNNGAALDSDSKSQRGS Sbjct: 1 MSDYEGEGDEMNNNNNGSPLLTKINNNGAALDSDSKSQRGS 41 >KZM94000.1 hypothetical protein DCAR_017245 [Daucus carota subsp. sativus] Length = 592 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = -1 Query: 559 MSDYEGEADEFNNN--GSPLLAKPNNNGAALDSDSKSQRGS 443 MSDYEGE DE NNN GSPLL K NNNGAALDSDSKSQRGS Sbjct: 1 MSDYEGEGDEMNNNNNGSPLLTKINNNGAALDSDSKSQRGS 41 >XP_017253021.1 PREDICTED: splicing factor U2af large subunit A isoform X1 [Daucus carota subsp. sativus] Length = 593 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/41 (85%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = -1 Query: 559 MSDYEGEADEFNNN--GSPLLAKPNNNGAALDSDSKSQRGS 443 MSDYEGE DE NNN GSPLL K NNNGAALDSDSKSQRGS Sbjct: 1 MSDYEGEGDEMNNNNNGSPLLTKINNNGAALDSDSKSQRGS 41