BLASTX nr result
ID: Angelica27_contig00008059
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00008059 (400 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215573.1 PREDICTED: probable pectate lyase 18 [Daucus caro... 59 1e-07 >XP_017215573.1 PREDICTED: probable pectate lyase 18 [Daucus carota subsp. sativus] KZM89125.1 hypothetical protein DCAR_026200 [Daucus carota subsp. sativus] Length = 407 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/50 (60%), Positives = 31/50 (62%) Frame = +3 Query: 3 LNGAFFTPXXXXXXXXXXXXXXXXXXRPSTLVGPLTVASGSLNCKKGSRC 152 LNGAFFTP RPSTLVG LTVA+GSLNCKKGSRC Sbjct: 358 LNGAFFTPSGAGGASSSYSRASSLGARPSTLVGQLTVAAGSLNCKKGSRC 407