BLASTX nr result
ID: Angelica27_contig00007484
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00007484 (1594 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009232766.1 ribosomal protein S18 (chloroplast) [Angelica acu... 195 3e-57 YP_740139.1 ribosomal protein S18 (chloroplast) [Daucus carota] ... 194 8e-57 YP_009338448.1 ribosomal protein S18 (chloroplast) [Pterygopleur... 192 2e-56 YP_009232851.1 ribosomal protein S18 (chloroplast) [Angelica dah... 192 2e-56 AKZ24382.1 ribosomal protein S18 (plastid) [Cicuta maculata] 192 3e-56 YP_009338279.1 ribosomal protein S18 (chloroplast) [Pleurospermu... 192 4e-56 YP_004222668.1 ribosomal protein S18 (chloroplast) [Anthriscus c... 192 4e-56 YP_009254237.1 ribosomal protein S18 (chloroplast) [Erythranthe ... 192 5e-56 YP_009245695.1 ribosomal protein S18 (chloroplast) [Carum carvi]... 191 6e-56 AKZ24383.1 ribosomal protein S18 (plastid) [Conium maculatum] 191 6e-56 YP_009155234.1 ribosomal protein S18 (plastid) [Pastinaca pimpin... 191 6e-56 ANS72136.1 ribosomal protein S18 (chloroplast) [Ledebouriella se... 191 9e-56 YP_009309473.1 ribosomal protein S18 (chloroplast) [Paulownia co... 191 1e-55 YP_009344458.1 ribosomal protein S18 (chloroplast) [Rehmannia ch... 190 2e-55 YP_009164339.1 ribosomal protein S18 (chloroplast) [Bupleurum fa... 190 2e-55 YP_009338530.1 ribosomal protein S18 (chloroplast) [Bupleurum la... 190 2e-55 YP_003359381.1 ribosomal protein S18 (chloroplast) [Olea europae... 189 7e-55 ALJ01923.1 ribosomal protein S18 (chloroplast) [Scrophularia den... 188 1e-54 YP_086988.1 ribosomal protein S18 [Panax ginseng] YP_008815139.1... 188 1e-54 YP_007507133.1 ribosomal protein S18 (chloroplast) [Salvia milti... 188 1e-54 >YP_009232766.1 ribosomal protein S18 (chloroplast) [Angelica acutiloba] AMA97857.1 ribosomal protein S18 (chloroplast) [Angelica acutiloba] Length = 101 Score = 195 bits (495), Expect = 3e-57 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >YP_740139.1 ribosomal protein S18 (chloroplast) [Daucus carota] YP_009155316.1 ribosomal protein S18 (plastid) [Seseli montanum] YP_009186275.1 ribosomal protein S18 (chloroplast) [Ostericum grosseserratum] YP_009232936.1 ribosomal protein S18 (chloroplast) [Angelica gigas] YP_009233021.1 ribosomal protein S18 (chloroplast) [Ligusticum tenuissimum] YP_009235901.1 ribosomal protein S18 (chloroplast) [Foeniculum vulgare] YP_009235986.1 ribosomal protein S18 (chloroplast) [Anethum graveolens] YP_009243588.1 ribosomal protein S18 (chloroplast) [Coriandrum sativum] YP_009331719.1 ribosomal protein S18 (chloroplast) [Arracacia xanthorrhiza] YP_009338363.1 ribosomal protein S18 (chloroplast) [Peucedanum insolens] Q0G9U0.1 RecName: Full=30S ribosomal protein S18, chloroplastic ABI32446.1 ribosomal protein S18 (chloroplast) [Daucus carota] ABU85200.1 ribosomal protein S18, partial (chloroplast) [Anethum graveolens] ADK89800.1 ribosomal protein S18 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] AIU99124.1 ribosomal protein S18 (plastid) [Seseli montanum] AKS03638.1 ribosomal protein S18 (chloroplast) [Coriandrum sativum] AKZ24384.1 ribosomal protein S18 (plastid) [Zizia aurea] ALN96870.1 ribosomal protein S18 (chloroplast) [Angelica decursiva] ALO71647.1 ribosomal protein S18 (chloroplast) [Ostericum grosseserratum] AMA98028.1 ribosomal protein S18 (chloroplast) [Angelica gigas] AMA98114.1 ribosomal protein S18 (chloroplast) [Ligusticum tenuissimum] AMD83937.1 ribosomal protein S18 (chloroplast) [Foeniculum vulgare] AMD84022.1 ribosomal protein S18 (chloroplast) [Anethum graveolens] KZM81244.1 ribosomal protein S18 (plastid) [Daucus carota subsp. sativus] ANK36458.1 ribosomal protein S18 (chloroplast) [Peucedanum insolens] ANS72052.1 ribosomal protein S18 (chloroplast) [Glehnia littoralis] APH07287.1 ribosomal protein S18 (chloroplast) [Arracacia xanthorrhiza] Length = 101 Score = 194 bits (492), Expect = 8e-57 Identities = 100/101 (99%), Positives = 101/101 (100%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >YP_009338448.1 ribosomal protein S18 (chloroplast) [Pterygopleurum neurophyllum] ANK36543.1 ribosomal protein S18 (chloroplast) [Pterygopleurum neurophyllum] Length = 101 Score = 192 bits (489), Expect = 2e-56 Identities = 99/101 (98%), Positives = 101/101 (100%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTT+TAGLRARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTKTAGLRARNK 101 >YP_009232851.1 ribosomal protein S18 (chloroplast) [Angelica dahurica] AMA97943.1 ribosomal protein S18 (chloroplast) [Angelica dahurica] Length = 101 Score = 192 bits (489), Expect = 2e-56 Identities = 99/101 (98%), Positives = 101/101 (100%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFR+RLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRKRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >AKZ24382.1 ribosomal protein S18 (plastid) [Cicuta maculata] Length = 101 Score = 192 bits (488), Expect = 3e-56 Identities = 99/101 (98%), Positives = 100/101 (99%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRR NRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRANRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >YP_009338279.1 ribosomal protein S18 (chloroplast) [Pleurospermum camtschaticum] ADK89973.1 ribosomal protein S18 (chloroplast) [Petroselinum crispum] ANK36374.1 ribosomal protein S18 (chloroplast) [Pleurospermum camtschaticum] Length = 101 Score = 192 bits (487), Expect = 4e-56 Identities = 99/101 (98%), Positives = 100/101 (99%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTEST RTAGLRARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTARTAGLRARNK 101 >YP_004222668.1 ribosomal protein S18 (chloroplast) [Anthriscus cerefolium] ADD13660.1 ribosomal protein S18 (chloroplast) [Anthriscus cerefolium] Length = 101 Score = 192 bits (487), Expect = 4e-56 Identities = 99/101 (98%), Positives = 100/101 (99%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTES TRTAGLRARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESNTRTAGLRARNK 101 >YP_009254237.1 ribosomal protein S18 (chloroplast) [Erythranthe lutea] ANC62937.1 ribosomal protein S18 (chloroplast) [Erythranthe lutea] Length = 103 Score = 192 bits (487), Expect = 5e-56 Identities = 99/101 (98%), Positives = 99/101 (98%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTTGLRTRNK 101 >YP_009245695.1 ribosomal protein S18 (chloroplast) [Carum carvi] AKS28710.1 ribosomal protein S18 (chloroplast) [Carum carvi] Length = 101 Score = 191 bits (486), Expect = 6e-56 Identities = 99/101 (98%), Positives = 100/101 (99%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRS RRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSLRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >AKZ24383.1 ribosomal protein S18 (plastid) [Conium maculatum] Length = 101 Score = 191 bits (486), Expect = 6e-56 Identities = 99/101 (98%), Positives = 100/101 (99%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTR AGLRARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRIAGLRARNK 101 >YP_009155234.1 ribosomal protein S18 (plastid) [Pastinaca pimpinellifolia] AIU99042.1 ribosomal protein S18 (plastid) [Pastinaca pimpinellifolia] Length = 101 Score = 191 bits (486), Expect = 6e-56 Identities = 99/101 (98%), Positives = 100/101 (99%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTE TTRTAGLRARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTELTTRTAGLRARNK 101 >ANS72136.1 ribosomal protein S18 (chloroplast) [Ledebouriella seseloides] Length = 101 Score = 191 bits (485), Expect = 9e-56 Identities = 98/101 (97%), Positives = 100/101 (99%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKS RSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSNRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAG+RARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGIRARNK 101 >YP_009309473.1 ribosomal protein S18 (chloroplast) [Paulownia coreana] YP_009309560.1 ribosomal protein S18 (chloroplast) [Paulownia tomentosa] AKM21534.1 ribosomal protein S18 (chloroplast) [Paulownia coreana] AKM21621.1 ribosomal protein S18 (chloroplast) [Paulownia tomentosa] Length = 101 Score = 191 bits (484), Expect = 1e-55 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTTGLRTRNK 101 >YP_009344458.1 ribosomal protein S18 (chloroplast) [Rehmannia chingii] APT42286.1 ribosomal protein S18 (chloroplast) [Rehmannia chingii] Length = 101 Score = 190 bits (483), Expect = 2e-55 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 101 >YP_009164339.1 ribosomal protein S18 (chloroplast) [Bupleurum falcatum] AIY72325.1 ribosomal protein S18 (chloroplast) [Bupleurum falcatum] Length = 101 Score = 190 bits (483), Expect = 2e-55 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTEST RTAG RARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTARTAGFRARNK 101 >YP_009338530.1 ribosomal protein S18 (chloroplast) [Bupleurum latissimum] ANK36625.1 ribosomal protein S18 (chloroplast) [Bupleurum latissimum] Length = 103 Score = 190 bits (483), Expect = 2e-55 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTEST RTAG RARNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTARTAGFRARNK 101 >YP_003359381.1 ribosomal protein S18 (chloroplast) [Olea europaea] YP_004376443.1 ribosomal protein S18 [Olea europaea subsp. europaea] YP_004563803.1 ribosomal protein S18 [Olea europaea subsp. cuspidata] YP_004564026.1 ribosomal protein S18 [Olea woodiana subsp. woodiana] YP_004564519.1 ribosomal protein S18 [Olea europaea subsp. maroccana] YP_004935688.1 ribosomal protein S18 (chloroplast) [Sesamum indicum] YP_009110624.1 ribosomal protein S18 (chloroplast) [Hesperelaea palmeri] YP_009309896.1 ribosomal protein S18 (chloroplast) [Abeliophyllum distichum] ABG74753.1 ribosomal protein S18 (chloroplast) [Forsythia europaea] ABG74806.1 ribosomal protein S18 (chloroplast) [Jasminum abyssinicum] ADA69948.1 ribosomal protein S18 (chloroplast) [Olea europaea] ADD30001.1 ribosomal protein S18 (chloroplast) [Antirrhinum majus] ADD72111.1 ribosomal protein S18 (chloroplast) [Olea europaea] CBR30337.1 ribosomal protein S18 (plastid) [Olea europaea subsp. europaea] CBR23852.1 ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] CBR24645.1 ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] CBR30428.1 ribosomal protein S18 (plastid) [Olea europaea subsp. europaea] CBS29374.1 ribosomal protein S18 (chloroplast) [Olea woodiana subsp. woodiana] CBS29264.1 ribosomal protein S18 (chloroplast) [Olea europaea subsp. maroccana] CBJ04320.1 ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] CBR23761.1 ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] AEO92728.1 ribosomal protein S18 (chloroplast) [Sesamum indicum] AGL45358.1 ribosomal protein S18 (chloroplast) [Sesamum indicum] CCQ09124.1 ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] CED79784.1 ribosomal protein S18 (chloroplast) [Hesperelaea palmeri] AKZ24371.1 ribosomal protein S18 (plastid) [Penstemon angustifolius] AKZ24372.1 ribosomal protein S18 (plastid) [Penstemon gracilis] ALZ50039.1 ribosomal protein S18 (chloroplast) [Abeliophyllum distichum] Length = 101 Score = 189 bits (479), Expect = 7e-55 Identities = 97/101 (96%), Positives = 98/101 (97%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTEST RT GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTARTTGLRTRNK 101 >ALJ01923.1 ribosomal protein S18 (chloroplast) [Scrophularia dentata] Length = 101 Score = 188 bits (478), Expect = 1e-54 Identities = 97/101 (96%), Positives = 98/101 (97%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLR R K Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTTGLRTRTK 101 >YP_086988.1 ribosomal protein S18 [Panax ginseng] YP_008815139.1 ribosomal protein S18 (chloroplast) [Schefflera delavayi] YP_008814878.1 ribosomal protein S18 (chloroplast) [Aralia undulata] YP_008815226.1 ribosomal protein S18 (chloroplast) [Kalopanax septemlobus] YP_009121195.1 ribosomal protein S18 (chloroplast) [Panax notoginseng] YP_009122747.1 ribosomal protein S18 (chloroplast) [Dendropanax dentiger] YP_009155450.1 ribosomal protein S18 (chloroplast) [Panax quinquefolius] YP_009159560.1 ribosomal protein S18 (chloroplast) [Dendropanax morbifer] YP_009191875.1 ribosomal protein S18 (chloroplast) [Panax japonicus] YP_009191962.1 ribosomal protein S18 (chloroplast) [Panax vietnamensis] YP_009266540.1 ribosomal protein S18 (chloroplast) [Panax stipuleanatus] Q68RY4.1 RecName: Full=30S ribosomal protein S18, chloroplastic AAT98531.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AGG38978.1 ribosomal protein S18 (chloroplast) [Aralia undulata] AGG39239.1 ribosomal protein S18 (chloroplast) [Schefflera delavayi] AGG39326.1 ribosomal protein S18 (chloroplast) [Kalopanax septemlobus] AGM15023.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AGM15109.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AGM15195.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AGW31955.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AIA24349.1 ribosomal protein S18 (chloroplast) [Panax notoginseng] AIX97911.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AIX97998.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AIX98081.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AIX98166.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AIX98251.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AIX98336.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AIX98421.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AIX98506.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AIX98591.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AJC99510.1 ribosomal protein S18 (chloroplast) [Panax quinquefolius] AJC99595.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AJC99680.1 ribosomal protein S18 (chloroplast) [Panax ginseng] AJK29896.1 ribosomal protein S18 (chloroplast) [Dendropanax dentiger] AKB99094.1 ribosomal protein S18 (chloroplast) [Panax notoginseng] AKB99181.1 ribosomal protein S18 (chloroplast) [Panax japonicus] AKB99268.1 ribosomal protein S18 (chloroplast) [Panax vietnamensis] AKB99355.1 ribosomal protein S18 (chloroplast) [Panax vietnamensis] AKG26622.1 ribosomal protein S18 (chloroplast) [Panax notoginseng] AKQ20750.1 ribosomal protein S18 (chloroplast) [Dendropanax morbifer] AKU70797.1 ribosomal protein S18 (chloroplast) [Panax notoginseng] AKZ29768.1 ribosomal protein S18 (chloroplast) [Panax quinquefolius] AMR97471.1 ribosomal protein S18 (chloroplast) [Panax vietnamensis] ANK78352.1 ribosomal protein S18 (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78438.1 ribosomal protein S18 (chloroplast) [Panax stipuleanatus] ANS71965.1 ribosomal protein S18 (chloroplast) [Aralia elata] Length = 101 Score = 188 bits (478), Expect = 1e-54 Identities = 97/101 (96%), Positives = 99/101 (98%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNN+KQFERTEST RTAGLRAR K Sbjct: 61 LITIAIKQARILSLLPFLNNDKQFERTESTARTAGLRARKK 101 >YP_007507133.1 ribosomal protein S18 (chloroplast) [Salvia miltiorrhiza] YP_009144536.1 ribosomal protein S18 (chloroplast) [Rosmarinus officinalis] YP_009270934.1 ribosomal protein S18 (chloroplast) [Perilla setoyensis] YP_009270758.1 ribosomal protein S18 (chloroplast) [Perilla citriodora] YP_009270846.1 ribosomal protein S18 (chloroplast) [Perilla frutescens] YP_009327409.1 ribosomal protein S18 (chloroplast) [Mentha longifolia] AFQ30951.1 ribosomal protein S18 (chloroplast) [Salvia miltiorrhiza] CCQ71642.1 ribosomal protein S18 (chloroplast) [Salvia miltiorrhiza] AKJ76768.1 ribosomal protein S18 (chloroplast) [Rosmarinus officinalis] AKJ77730.1 ribosomal protein S18 (chloroplast) [Perilla frutescens] AKZ24369.1 ribosomal protein S18 (plastid) [Nepeta cataria] AKZ24370.1 ribosomal protein S18 (plastid) [Salvia nemorosa] AMR74130.1 ribosomal protein S18 (chloroplast) [Perilla frutescens] AMR74218.1 ribosomal protein S18 (chloroplast) [Perilla frutescens var. acuta] AMR74306.1 ribosomal protein S18 (chloroplast) [Perilla frutescens f. crispidiscolor] AMR74394.1 ribosomal protein S18 (chloroplast) [Perilla frutescens var. crispa] AMR74482.1 ribosomal protein S18 (chloroplast) [Perilla frutescens var. crispa] AMR74570.1 ribosomal protein S18 (chloroplast) [Perilla frutescens var. frutescens] AMR74658.1 ribosomal protein S18 (chloroplast) [Perilla citriodora] AMR74746.1 ribosomal protein S18 (chloroplast) [Perilla frutescens var. hirtella] AMR74834.1 ribosomal protein S18 (chloroplast) [Perilla setoyensis] AOW32173.1 ribosomal protein S18 (chloroplast) [Mentha longifolia] Length = 101 Score = 188 bits (478), Expect = 1e-54 Identities = 97/101 (96%), Positives = 98/101 (97%) Frame = +3 Query: 1239 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 1418 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 1419 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 1541 LITIAIKQARILSLLPFLNNEKQFER ESTTRT GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERIESTTRTTGLRTRNK 101