BLASTX nr result
ID: Angelica27_contig00007431
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00007431 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017235606.1 PREDICTED: probable pre-mRNA-splicing factor ATP-... 67 3e-11 KYP47596.1 putative pre-mRNA-splicing factor ATP-dependent RNA h... 52 3e-06 >XP_017235606.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 [Daucus carota subsp. sativus] KZN04905.1 hypothetical protein DCAR_005742 [Daucus carota subsp. sativus] Length = 723 Score = 66.6 bits (161), Expect = 3e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 109 MGTERKRKVSLFDVVDDSPIAKLNKTNGAFSNSVNS 2 MGTERKRKVSLFDVVDDS I+KLNKTNGA SNSVNS Sbjct: 1 MGTERKRKVSLFDVVDDSAISKLNKTNGAVSNSVNS 36 >KYP47596.1 putative pre-mRNA-splicing factor ATP-dependent RNA helicase [Cajanus cajan] Length = 683 Score = 52.4 bits (124), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 109 MGTERKRKVSLFDVVDDSPIAKLNKTNGAFSNSV 8 MGTERKRKVSLFDVVDDS +AK+ KTNG +NSV Sbjct: 1 MGTERKRKVSLFDVVDDS-VAKMAKTNGGANNSV 33