BLASTX nr result
ID: Angelica27_contig00007385
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00007385 (560 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM84571.1 hypothetical protein DCAR_028007 [Daucus carota subsp... 55 3e-07 KZM84573.1 hypothetical protein DCAR_028005 [Daucus carota subsp... 52 7e-06 >KZM84571.1 hypothetical protein DCAR_028007 [Daucus carota subsp. sativus] Length = 65 Score = 55.5 bits (132), Expect = 3e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 235 IPRRGQVKAGIVVGLAQSVASVFSSTARAKPSAA 336 IPRRGQVKAGIV+GLAQSVASVFS AR K S+A Sbjct: 26 IPRRGQVKAGIVIGLAQSVASVFSPNARTKASSA 59 >KZM84573.1 hypothetical protein DCAR_028005 [Daucus carota subsp. sativus] Length = 61 Score = 51.6 bits (122), Expect = 7e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 235 IPRRGQVKAGIVVGLAQSVASVFSSTARAK 324 IP+RGQVKAGIV+GLAQSVASVFS ARAK Sbjct: 29 IPKRGQVKAGIVLGLAQSVASVFSPRARAK 58