BLASTX nr result
ID: Angelica27_contig00007236
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00007236 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219461.1 PREDICTED: guanine nucleotide-binding protein sub... 79 2e-15 KHN21658.1 Guanine nucleotide-binding protein subunit beta-like ... 77 4e-15 XP_011084467.1 PREDICTED: LOW QUALITY PROTEIN: guanine nucleotid... 78 6e-15 XP_015966958.1 PREDICTED: guanine nucleotide-binding protein sub... 78 7e-15 KRH60497.1 hypothetical protein GLYMA_05G243800 [Glycine max] 77 1e-14 KVI04616.1 G-protein beta WD-40 repeat-containing protein [Cynar... 77 1e-14 XP_016730517.1 PREDICTED: guanine nucleotide-binding protein sub... 76 2e-14 XP_016718295.1 PREDICTED: guanine nucleotide-binding protein sub... 76 2e-14 XP_012440318.1 PREDICTED: guanine nucleotide-binding protein sub... 76 2e-14 XP_017636115.1 PREDICTED: guanine nucleotide-binding protein sub... 76 2e-14 XP_012486409.1 PREDICTED: guanine nucleotide-binding protein sub... 76 2e-14 XP_016680135.1 PREDICTED: guanine nucleotide-binding protein sub... 76 2e-14 KYP67473.1 Guanine nucleotide-binding protein subunit beta-like ... 75 5e-14 XP_014517721.1 PREDICTED: guanine nucleotide-binding protein sub... 75 5e-14 XP_017425697.1 PREDICTED: guanine nucleotide-binding protein sub... 75 5e-14 XP_007160506.1 hypothetical protein PHAVU_002G327500g [Phaseolus... 75 5e-14 ACJ24167.1 Rack [Phaseolus vulgaris] 75 5e-14 AGV54321.1 RACK1 [Phaseolus vulgaris] 75 5e-14 NP_001235369.1 guanine nucleotide-binding protein subunit beta-l... 75 5e-14 P93340.1 RecName: Full=Guanine nucleotide-binding protein subuni... 75 7e-14 >XP_017219461.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Daucus carota subsp. sativus] KZM88305.1 hypothetical protein DCAR_025380 [Daucus carota subsp. sativus] Length = 329 Score = 79.3 bits (194), Expect = 2e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NAGKNKVIYCTSL+WSADGSTLFSGYTDGVVRVW I R+ Sbjct: 291 NAGKNKVIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY 329 >KHN21658.1 Guanine nucleotide-binding protein subunit beta-like protein [Glycine soja] Length = 223 Score = 77.0 bits (188), Expect = 4e-15 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NA K KVIYCTSLNWSADGSTLFSGYTDGVVRVW+I R+ Sbjct: 185 NANKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY 223 >XP_011084467.1 PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein subunit beta-like protein [Sesamum indicum] Length = 318 Score = 77.8 bits (190), Expect = 6e-15 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 5 AGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 +GKNKVIYCTSLNWSADGSTLFSGYTDGVVRVW I R+ Sbjct: 281 SGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRY 318 >XP_015966958.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Arachis duranensis] Length = 324 Score = 77.8 bits (190), Expect = 7e-15 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NA K KVIYCTSLNWSADGSTLFSGYTDGVVRVW I RF Sbjct: 286 NANKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWGIGRF 324 >KRH60497.1 hypothetical protein GLYMA_05G243800 [Glycine max] Length = 325 Score = 77.0 bits (188), Expect = 1e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NA K KVIYCTSLNWSADGSTLFSGYTDGVVRVW+I R+ Sbjct: 287 NANKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY 325 >KVI04616.1 G-protein beta WD-40 repeat-containing protein [Cynara cardunculus var. scolymus] Length = 329 Score = 77.0 bits (188), Expect = 1e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NAGK KVIYCTSL+WSADGSTLFSGYTDGVVRVW I R+ Sbjct: 291 NAGKTKVIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY 329 >XP_016730517.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Gossypium hirsutum] Length = 326 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NA K KVIYCTSLNWSADGSTLFSGYTDGV+RVW I R+ Sbjct: 288 NANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY 326 >XP_016718295.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Gossypium hirsutum] Length = 326 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NA K KVIYCTSLNWSADGSTLFSGYTDGV+RVW I R+ Sbjct: 288 NANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY 326 >XP_012440318.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Gossypium raimondii] KJB53022.1 hypothetical protein B456_008G288800 [Gossypium raimondii] Length = 326 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NA K KVIYCTSLNWSADGSTLFSGYTDGV+RVW I R+ Sbjct: 288 NANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY 326 >XP_017636115.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Gossypium arboreum] KHG17882.1 Guanine nucleotide-binding protein subunit beta-like protein [Gossypium arboreum] Length = 326 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NA K KVIYCTSLNWSADGSTLFSGYTDGV+RVW I R+ Sbjct: 288 NANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY 326 >XP_012486409.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein isoform X1 [Gossypium raimondii] XP_016670914.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Gossypium hirsutum] KJB37175.1 hypothetical protein B456_006G192600 [Gossypium raimondii] Length = 327 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NA K KVIYCTSLNWSADGSTLFSGYTDGV+RVW I R+ Sbjct: 289 NANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY 327 >XP_016680135.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Gossypium hirsutum] XP_017611477.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Gossypium arboreum] KHG00880.1 Guanine nucleotide-binding protein subunit beta-like protein [Gossypium arboreum] Length = 327 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NA K KVIYCTSLNWSADGSTLFSGYTDGV+RVW I R+ Sbjct: 289 NANKKKVIYCTSLNWSADGSTLFSGYTDGVIRVWGIGRY 327 >KYP67473.1 Guanine nucleotide-binding protein subunit beta-like protein [Cajanus cajan] Length = 324 Score = 75.5 bits (184), Expect = 5e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 N K KVIYCTSLNWSADGSTLFSGYTDGVVRVW+I R+ Sbjct: 286 NTNKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY 324 >XP_014517721.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Vigna radiata var. radiata] Length = 324 Score = 75.5 bits (184), Expect = 5e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 N K KVIYCTSLNWSADGSTLFSGYTDGVVRVW+I R+ Sbjct: 286 NTNKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY 324 >XP_017425697.1 PREDICTED: guanine nucleotide-binding protein subunit beta-like protein [Vigna angularis] KOM43403.1 hypothetical protein LR48_Vigan05g100700 [Vigna angularis] Length = 324 Score = 75.5 bits (184), Expect = 5e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 N K KVIYCTSLNWSADGSTLFSGYTDGVVRVW+I R+ Sbjct: 286 NTNKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY 324 >XP_007160506.1 hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris] ACV72060.1 RACK1 [Phaseolus vulgaris] ESW32500.1 hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris] BAT72652.1 hypothetical protein VIGAN_01007800 [Vigna angularis var. angularis] Length = 324 Score = 75.5 bits (184), Expect = 5e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 N K KVIYCTSLNWSADGSTLFSGYTDGVVRVW+I R+ Sbjct: 286 NTNKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY 324 >ACJ24167.1 Rack [Phaseolus vulgaris] Length = 324 Score = 75.5 bits (184), Expect = 5e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 N K KVIYCTSLNWSADGSTLFSGYTDGVVRVW+I R+ Sbjct: 286 NTNKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY 324 >AGV54321.1 RACK1 [Phaseolus vulgaris] Length = 324 Score = 75.5 bits (184), Expect = 5e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 N K KVIYCTSLNWSADGSTLFSGYTDGVVRVW+I R+ Sbjct: 286 NTNKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY 324 >NP_001235369.1 guanine nucleotide-binding protein subunit beta-like protein [Glycine max] Q39836.1 RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein AAB05941.1 G beta-like protein [Glycine max] Length = 325 Score = 75.5 bits (184), Expect = 5e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 NA K KVIYCTSLNWSADGSTLFSGYTDGV RVW+I R+ Sbjct: 287 NANKKKVIYCTSLNWSADGSTLFSGYTDGVARVWAIGRY 325 >P93340.1 RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein CAA70705.1 G protein beta subunit [Nicotiana plumbaginifolia] Length = 326 Score = 75.1 bits (183), Expect = 7e-14 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 5 AGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 118 +GKNKVIYCTSL WSADGSTLFSGYTDG++RVW I RF Sbjct: 289 SGKNKVIYCTSLGWSADGSTLFSGYTDGLIRVWGIGRF 326