BLASTX nr result
ID: Angelica27_contig00007064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00007064 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EOY28010.1 General regulatory factor 12, IOTA isoform 3 [Theobro... 63 4e-10 KRY02667.1 14-3-3-like protein B [Trichinella patagoniensis] 58 2e-09 OIV93347.1 hypothetical protein TanjilG_23283 [Lupinus angustifo... 59 2e-09 KIY46485.1 14-3-3 protein, partial [Fistulina hepatica ATCC 64428] 58 2e-09 GAU51993.1 hypothetical protein TSUD_137420 [Trifolium subterran... 57 2e-09 ADU04752.1 14-3-3-like protein, partial [Mesostigma viride] 60 3e-09 ADU04753.1 14-3-3-like protein, partial [Mesostigma viride] 60 3e-09 EJK72761.1 hypothetical protein THAOC_05673, partial [Thalassios... 57 3e-09 CEI97107.1 Putative 14-3-3 family protein epsilon [Rhizopus micr... 59 3e-09 AHM25024.1 CL14-3-3d [Cunninghamia lanceolata] 60 5e-09 ABK95682.1 unknown [Populus trichocarpa] 57 5e-09 KNA21419.1 hypothetical protein SOVF_043340, partial [Spinacia o... 59 5e-09 OAE21770.1 hypothetical protein AXG93_2550s1070 [Marchantia poly... 60 6e-09 XP_001761013.1 predicted protein [Physcomitrella patens] EDQ7408... 60 6e-09 KHN20521.1 14-3-3-like protein GF14 iota [Glycine soja] 60 6e-09 XP_016688067.1 PREDICTED: 14-3-3-like protein B [Gossypium hirsu... 58 7e-09 XP_001764363.1 predicted protein [Physcomitrella patens] EDQ7091... 60 7e-09 XP_001776144.1 predicted protein [Physcomitrella patens] EDQ5905... 60 7e-09 XP_001782988.1 predicted protein [Physcomitrella patens] EDQ5218... 60 7e-09 ABK24279.1 unknown [Picea sitchensis] ABK26478.1 unknown [Picea ... 60 7e-09 >EOY28010.1 General regulatory factor 12, IOTA isoform 3 [Theobroma cacao] Length = 276 Score = 63.2 bits (152), Expect = 4e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +2 Query: 104 CGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 CG +L+L RACHLAKQAFDEAI+ELDTLSEESYKDS Sbjct: 212 CGTPCYVLNLYTRACHLAKQAFDEAISELDTLSEESYKDS 251 >KRY02667.1 14-3-3-like protein B [Trichinella patagoniensis] Length = 74 Score = 57.8 bits (138), Expect = 2e-09 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +2 Query: 140 RACHLAKQAFDEAIAELDTLSEESYKDS 223 RACHLAKQAFDEAI+ELDTLSEESYKDS Sbjct: 6 RACHLAKQAFDEAISELDTLSEESYKDS 33 >OIV93347.1 hypothetical protein TanjilG_23283 [Lupinus angustifolius] Length = 125 Score = 58.9 bits (141), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 140 RACHLAKQAFDEAIAELDTLSEESYKDS 223 RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 6 RACHLAKQAFDEAIAELDTLSEESYKDS 33 >KIY46485.1 14-3-3 protein, partial [Fistulina hepatica ATCC 64428] Length = 86 Score = 57.8 bits (138), Expect = 2e-09 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +2 Query: 140 RACHLAKQAFDEAIAELDTLSEESYKDS 223 RACHLAKQAFD+AIAELDTLSEESYKDS Sbjct: 41 RACHLAKQAFDDAIAELDTLSEESYKDS 68 >GAU51993.1 hypothetical protein TSUD_137420 [Trifolium subterraneum] Length = 59 Score = 57.0 bits (136), Expect = 2e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 122 LLSLIFRACHLAKQAFDEAIAELDTLSEESYKD 220 +L + RACHLAKQAFDEAI+ELDTLSEESYKD Sbjct: 1 MLLVTCRACHLAKQAFDEAISELDTLSEESYKD 33 >ADU04752.1 14-3-3-like protein, partial [Mesostigma viride] Length = 173 Score = 59.7 bits (143), Expect = 3e-09 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 127 GLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDS 172 >ADU04753.1 14-3-3-like protein, partial [Mesostigma viride] Length = 175 Score = 59.7 bits (143), Expect = 3e-09 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 129 GLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDS 174 >EJK72761.1 hypothetical protein THAOC_05673, partial [Thalassiosira oceanica] Length = 65 Score = 57.0 bits (136), Expect = 3e-09 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +2 Query: 140 RACHLAKQAFDEAIAELDTLSEESYKDS 223 RACH+AKQAFD+AIAELDTLSEESYKDS Sbjct: 7 RACHIAKQAFDDAIAELDTLSEESYKDS 34 >CEI97107.1 Putative 14-3-3 family protein epsilon [Rhizopus microsporus] CEI88405.1 Putative 14-3-3 family protein epsilon [Rhizopus microsporus] Length = 130 Score = 58.5 bits (140), Expect = 3e-09 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFD+AIAELDTLSEESYKDS Sbjct: 48 GLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELDTLSEESYKDS 93 >AHM25024.1 CL14-3-3d [Cunninghamia lanceolata] Length = 259 Score = 60.1 bits (144), Expect = 5e-09 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 175 GLALNFSVFYYEILNAPERACHLAKQAFDEAIAELDTLSEESYKDS 220 >ABK95682.1 unknown [Populus trichocarpa] Length = 73 Score = 56.6 bits (135), Expect = 5e-09 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +2 Query: 140 RACHLAKQAFDEAIAELDTLSEESYKDS 223 RACHLAKQ+FDEAI+ELDTLSEESYKDS Sbjct: 6 RACHLAKQSFDEAISELDTLSEESYKDS 33 >KNA21419.1 hypothetical protein SOVF_043340, partial [Spinacia oleracea] Length = 177 Score = 58.9 bits (141), Expect = 5e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 140 RACHLAKQAFDEAIAELDTLSEESYKDS 223 RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 128 RACHLAKQAFDEAIAELDTLSEESYKDS 155 >OAE21770.1 hypothetical protein AXG93_2550s1070 [Marchantia polymorpha subsp. polymorpha] Length = 239 Score = 59.7 bits (143), Expect = 6e-09 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 150 GLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDS 195 >XP_001761013.1 predicted protein [Physcomitrella patens] EDQ74080.1 predicted protein, partial [Physcomitrella patens] Length = 246 Score = 59.7 bits (143), Expect = 6e-09 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 175 GLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDS 220 >KHN20521.1 14-3-3-like protein GF14 iota [Glycine soja] Length = 249 Score = 59.7 bits (143), Expect = 6e-09 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 175 GLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDS 220 >XP_016688067.1 PREDICTED: 14-3-3-like protein B [Gossypium hirsutum] Length = 132 Score = 57.8 bits (138), Expect = 7e-09 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +2 Query: 140 RACHLAKQAFDEAIAELDTLSEESYKDS 223 RACHLAKQAFDEAI+ELDTLSEESYKDS Sbjct: 67 RACHLAKQAFDEAISELDTLSEESYKDS 94 >XP_001764363.1 predicted protein [Physcomitrella patens] EDQ70917.1 predicted protein [Physcomitrella patens] Length = 258 Score = 59.7 bits (143), Expect = 7e-09 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 175 GLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDS 220 >XP_001776144.1 predicted protein [Physcomitrella patens] EDQ59055.1 predicted protein [Physcomitrella patens] Length = 258 Score = 59.7 bits (143), Expect = 7e-09 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 175 GLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDS 220 >XP_001782988.1 predicted protein [Physcomitrella patens] EDQ52187.1 predicted protein [Physcomitrella patens] Length = 258 Score = 59.7 bits (143), Expect = 7e-09 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 175 GLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDS 220 >ABK24279.1 unknown [Picea sitchensis] ABK26478.1 unknown [Picea sitchensis] Length = 258 Score = 59.7 bits (143), Expect = 7e-09 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 86 GFRASICGFERRLLSLIFRACHLAKQAFDEAIAELDTLSEESYKDS 223 G + F +L+ RACHLAKQAFDEAIAELDTLSEESYKDS Sbjct: 174 GLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDS 219