BLASTX nr result
ID: Angelica27_contig00005675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00005675 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017228011.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Daucu... 79 3e-15 XP_015892952.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Zizip... 77 1e-14 KVH91074.1 hypothetical protein Ccrd_006914 [Cynara cardunculus ... 76 2e-14 XP_006486555.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Citru... 75 5e-14 XP_004290093.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Fraga... 75 5e-14 XP_010270590.1 PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [... 75 1e-13 XP_007142585.1 hypothetical protein PHAVU_008G293200g [Phaseolus... 74 1e-13 GAU17615.1 hypothetical protein TSUD_254900 [Trifolium subterran... 72 2e-13 KDP47039.1 hypothetical protein JCGZ_10766 [Jatropha curcas] 74 2e-13 OAY29055.1 hypothetical protein MANES_15G114400 [Manihot esculenta] 74 2e-13 XP_015571858.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Ricin... 74 2e-13 XP_012076018.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Jatro... 74 2e-13 XP_008235837.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Prunu... 74 2e-13 XP_007201166.1 hypothetical protein PRUPE_ppa003787mg [Prunus pe... 74 2e-13 XP_004491653.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Cicer... 74 3e-13 XP_008448156.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Cucum... 74 3e-13 XP_004139980.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Cucum... 74 3e-13 KGN46639.1 hypothetical protein Csa_6G117700 [Cucumis sativus] 74 3e-13 XP_010645554.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Vitis... 73 4e-13 CBI37713.3 unnamed protein product, partial [Vitis vinifera] 73 4e-13 >XP_017228011.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Daucus carota subsp. sativus] Length = 543 Score = 79.0 bits (193), Expect = 3e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AELDN NQ+CEVYRA LL VLRDMEDQKLKLSVKVQN RLSLKD Sbjct: 500 AELDNTNQRCEVYRANLLAVLRDMEDQKLKLSVKVQNVRLSLKD 543 >XP_015892952.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Ziziphus jujuba] Length = 549 Score = 77.4 bits (189), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL+N NQ+CEVYRA LL VLRDMEDQKLKLSVKVQNARLSLK+ Sbjct: 506 AELENTNQRCEVYRANLLAVLRDMEDQKLKLSVKVQNARLSLKE 549 >KVH91074.1 hypothetical protein Ccrd_006914 [Cynara cardunculus var. scolymus] Length = 369 Score = 76.3 bits (186), Expect = 2e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AELDN N++CEVYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 326 AELDNTNERCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 369 >XP_006486555.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Citrus sinensis] XP_006486556.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Citrus sinensis] Length = 548 Score = 75.5 bits (184), Expect = 5e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL+N NQ+CEVYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 505 AELENINQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 548 >XP_004290093.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Fragaria vesca subsp. vesca] Length = 549 Score = 75.5 bits (184), Expect = 5e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AELDN NQ+CEVYRA LL VLRDME+QKLKLSVKVQ+ARLSLK+ Sbjct: 506 AELDNTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQSARLSLKE 549 >XP_010270590.1 PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera] Length = 783 Score = 74.7 bits (182), Expect = 1e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 +ELDNANQ+CEVYRA LL +L+DME+QKLKLSVKVQN RL LKD Sbjct: 740 SELDNANQRCEVYRANLLAILKDMEEQKLKLSVKVQNVRLGLKD 783 >XP_007142585.1 hypothetical protein PHAVU_008G293200g [Phaseolus vulgaris] ESW14579.1 hypothetical protein PHAVU_008G293200g [Phaseolus vulgaris] Length = 548 Score = 74.3 bits (181), Expect = 1e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL+ ANQQCEVYRA LL VL+DME+QKLKLSVKVQNARLSLK+ Sbjct: 505 AELEVANQQCEVYRANLLAVLKDMEEQKLKLSVKVQNARLSLKE 548 >GAU17615.1 hypothetical protein TSUD_254900 [Trifolium subterraneum] Length = 188 Score = 71.6 bits (174), Expect = 2e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL+ NQ+C VYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 145 AELETTNQRCNVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 188 >KDP47039.1 hypothetical protein JCGZ_10766 [Jatropha curcas] Length = 527 Score = 73.9 bits (180), Expect = 2e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL++ NQ+CEVYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 484 AELESTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 527 >OAY29055.1 hypothetical protein MANES_15G114400 [Manihot esculenta] Length = 549 Score = 73.9 bits (180), Expect = 2e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL++ NQ+CEVYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 506 AELESTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 549 >XP_015571858.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Ricinus communis] Length = 549 Score = 73.9 bits (180), Expect = 2e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL++ NQ+CEVYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 506 AELESTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 549 >XP_012076018.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Jatropha curcas] Length = 549 Score = 73.9 bits (180), Expect = 2e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL++ NQ+CEVYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 506 AELESTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 549 >XP_008235837.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Prunus mume] Length = 549 Score = 73.9 bits (180), Expect = 2e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL+N NQ+CEVYRA LL VLRDME+QKLKLSVKVQ+ARLSLK+ Sbjct: 506 AELENTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQSARLSLKE 549 >XP_007201166.1 hypothetical protein PRUPE_ppa003787mg [Prunus persica] ONH92592.1 hypothetical protein PRUPE_8G182800 [Prunus persica] Length = 549 Score = 73.9 bits (180), Expect = 2e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL+N NQ+CEVYRA LL VLRDME+QKLKLSVKVQ+ARLSLK+ Sbjct: 506 AELENTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQSARLSLKE 549 >XP_004491653.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Cicer arietinum] Length = 548 Score = 73.6 bits (179), Expect = 3e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL+ NQ+CEVYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 505 AELETTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 548 >XP_008448156.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Cucumis melo] Length = 550 Score = 73.6 bits (179), Expect = 3e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL+ NQ+CEVYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 507 AELEKTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 550 >XP_004139980.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Cucumis sativus] XP_011656902.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Cucumis sativus] Length = 550 Score = 73.6 bits (179), Expect = 3e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL+ NQ+CEVYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 507 AELEKTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 550 >KGN46639.1 hypothetical protein Csa_6G117700 [Cucumis sativus] Length = 610 Score = 73.6 bits (179), Expect = 3e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 AEL+ NQ+CEVYRA LL VLRDME+QKLKLSVKVQNARLSLK+ Sbjct: 567 AELEKTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 610 >XP_010645554.1 PREDICTED: protein FAR1-RELATED SEQUENCE 9 [Vitis vinifera] Length = 549 Score = 73.2 bits (178), Expect = 4e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 +EL++ NQ+CEVYRA LL VL+DMEDQKLKLSVKVQNARLSLK+ Sbjct: 506 SELESTNQRCEVYRANLLAVLKDMEDQKLKLSVKVQNARLSLKE 549 >CBI37713.3 unnamed protein product, partial [Vitis vinifera] Length = 604 Score = 73.2 bits (178), Expect = 4e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 274 AELDNANQQCEVYRAKLLGVLRDMEDQKLKLSVKVQNARLSLKD 143 +EL++ NQ+CEVYRA LL VL+DMEDQKLKLSVKVQNARLSLK+ Sbjct: 561 SELESTNQRCEVYRANLLAVLKDMEDQKLKLSVKVQNARLSLKE 604