BLASTX nr result
ID: Angelica27_contig00005020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00005020 (266 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017250159.1 PREDICTED: probable WRKY transcription factor 65 ... 67 2e-11 XP_017237662.1 PREDICTED: probable WRKY transcription factor 69 ... 63 6e-10 >XP_017250159.1 PREDICTED: probable WRKY transcription factor 65 [Daucus carota subsp. sativus] Length = 247 Score = 67.0 bits (162), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = -1 Query: 143 MESSTSPVLK--PKILEEKLDTQHSKKRKLSEKTVVTVKIEDGENKKQK 3 M++STSP+L PKIL+EK DTQ KKRK+SEKTVVTVKIE+ ENKK K Sbjct: 1 MDTSTSPMLDLDPKILQEKSDTQPPKKRKMSEKTVVTVKIEENENKKHK 49 >XP_017237662.1 PREDICTED: probable WRKY transcription factor 69 [Daucus carota subsp. sativus] KZN03581.1 hypothetical protein DCAR_012337 [Daucus carota subsp. sativus] Length = 260 Score = 63.2 bits (152), Expect = 6e-10 Identities = 34/47 (72%), Positives = 36/47 (76%) Frame = -1 Query: 143 MESSTSPVLKPKILEEKLDTQHSKKRKLSEKTVVTVKIEDGENKKQK 3 M+ S SP L KI EEK DTQ SKKRK+SEKTVVTVKIE ENKK K Sbjct: 1 MDCSPSPSLDLKISEEKSDTQTSKKRKMSEKTVVTVKIEANENKKHK 47