BLASTX nr result
ID: Angelica27_contig00003027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00003027 (350 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM84629.1 hypothetical protein DCAR_027949 [Daucus carota subsp... 77 4e-15 GAU49873.1 hypothetical protein TSUD_366290 [Trifolium subterran... 74 4e-14 XP_017221028.1 PREDICTED: mitochondrial inner membrane protease ... 74 5e-14 CDP06341.1 unnamed protein product [Coffea canephora] 73 7e-14 XP_013445096.1 inner membrane protease subunit-like protein [Med... 73 8e-14 GAU49874.1 hypothetical protein TSUD_366300 [Trifolium subterran... 72 1e-13 AIC80765.1 signal peptidase S24 [Cicer arietinum] 70 6e-13 XP_004511043.1 PREDICTED: mitochondrial inner membrane protease ... 70 6e-13 KHN47457.1 Mitochondrial inner membrane protease subunit 1 [Glyc... 68 8e-13 XP_011460173.1 PREDICTED: mitochondrial inner membrane protease ... 70 9e-13 XP_019413263.1 PREDICTED: mitochondrial inner membrane protease ... 70 1e-12 XP_016499929.1 PREDICTED: mitochondrial inner membrane protease ... 70 1e-12 XP_015063868.1 PREDICTED: mitochondrial inner membrane protease ... 70 1e-12 XP_009596099.1 PREDICTED: mitochondrial inner membrane protease ... 70 1e-12 XP_006365568.1 PREDICTED: mitochondrial inner membrane protease ... 70 1e-12 XP_004233102.1 PREDICTED: mitochondrial inner membrane protease ... 70 1e-12 XP_013445098.1 inner membrane protease subunit 1 [Medicago trunc... 69 2e-12 KYP36218.1 hypothetical protein KK1_042673, partial [Cajanus cajan] 71 2e-12 XP_019226809.1 PREDICTED: mitochondrial inner membrane protease ... 69 2e-12 XP_009801823.1 PREDICTED: mitochondrial inner membrane protease ... 69 2e-12 >KZM84629.1 hypothetical protein DCAR_027949 [Daucus carota subsp. sativus] Length = 197 Score = 77.0 bits (188), Expect = 4e-15 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWKFAAISFLRSFVKQAYNL 190 VPKGHVWI+GDNK+ SRDS+ FGPVPY MI+GRIFWK +A + +V Q + Sbjct: 115 VPKGHVWIEGDNKYMSRDSKNFGPVPYGMIQGRIFWKVSAFFDVYIYVSQVIRM 168 >GAU49873.1 hypothetical protein TSUD_366290 [Trifolium subterraneum] Length = 162 Score = 73.6 bits (179), Expect = 4e-14 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWKFAAISFLRSFVKQ 178 VPKGHVW++GDNK+NS DSR FGPVPY +IE ++FW+ + + SF K+ Sbjct: 113 VPKGHVWVEGDNKYNSNDSRSFGPVPYGLIENKLFWRVSPLKDFGSFWKK 162 >XP_017221028.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Daucus carota subsp. sativus] XP_017221029.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Daucus carota subsp. sativus] XP_017221030.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Daucus carota subsp. sativus] Length = 166 Score = 73.6 bits (179), Expect = 5e-14 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWK 139 VPKGHVWI+GDNK+ SRDS+ FGPVPY MI+GRIFWK Sbjct: 115 VPKGHVWIEGDNKYMSRDSKNFGPVPYGMIQGRIFWK 151 >CDP06341.1 unnamed protein product [Coffea canephora] Length = 173 Score = 73.2 bits (178), Expect = 7e-14 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFW 136 VPKGH+WI+GDNK NSRDSR FGPVPY ++EGR+FW Sbjct: 110 VPKGHIWIEGDNKHNSRDSRQFGPVPYGLLEGRVFW 145 >XP_013445096.1 inner membrane protease subunit-like protein [Medicago truncatula] AFK39109.1 unknown [Medicago truncatula] KEH19122.1 inner membrane protease subunit-like protein [Medicago truncatula] Length = 162 Score = 72.8 bits (177), Expect = 8e-14 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWKFAAISFLRSF 169 VPKGHVWI+GDNK+ S DSR FGPVPY +IE R+FWK + + SF Sbjct: 113 VPKGHVWIEGDNKYKSNDSRNFGPVPYGLIESRLFWKVSPLKDFGSF 159 >GAU49874.1 hypothetical protein TSUD_366300 [Trifolium subterraneum] Length = 162 Score = 72.4 bits (176), Expect = 1e-13 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWKFAAISFLRSF 169 VPKGHVW+QGDNK+NS DSR FGP+PY +IE +IFW+ + SF Sbjct: 113 VPKGHVWVQGDNKYNSNDSRNFGPIPYGLIESKIFWRVWPLKGFGSF 159 >AIC80765.1 signal peptidase S24 [Cicer arietinum] Length = 155 Score = 70.5 bits (171), Expect = 6e-13 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWK 139 VPKGHVW+QGDN +NS DSR+FGPVPY +IE ++FW+ Sbjct: 113 VPKGHVWVQGDNTYNSNDSRHFGPVPYGLIESKLFWR 149 >XP_004511043.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Cicer arietinum] Length = 162 Score = 70.5 bits (171), Expect = 6e-13 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWK 139 VPKGHVW+QGDN +NS DSR+FGPVPY +IE ++FW+ Sbjct: 113 VPKGHVWVQGDNTYNSNDSRHFGPVPYGLIESKLFWR 149 >KHN47457.1 Mitochondrial inner membrane protease subunit 1 [Glycine soja] Length = 72 Score = 67.8 bits (164), Expect = 8e-13 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWK 139 VPKGHVWIQGDN + SRDSR+FGPVPY +IEG++F++ Sbjct: 24 VPKGHVWIQGDNIYASRDSRHFGPVPYGLIEGKVFFR 60 >XP_011460173.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Fragaria vesca subsp. vesca] XP_011460174.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Fragaria vesca subsp. vesca] Length = 180 Score = 70.5 bits (171), Expect = 9e-13 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWKF 142 VPKGHVW+QGDN ++S DSR FGPVPY +++GR+FW+F Sbjct: 124 VPKGHVWVQGDNIYDSNDSRKFGPVPYGLLQGRVFWRF 161 >XP_019413263.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Lupinus angustifolius] OIV99065.1 hypothetical protein TanjilG_32324 [Lupinus angustifolius] Length = 167 Score = 69.7 bits (169), Expect = 1e-12 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWKFAAISFLRSFVK 175 VPKGHVW+QGDN + S DSR FGPVPY +I+GRIFW+ + + F K Sbjct: 118 VPKGHVWVQGDNIYKSTDSRNFGPVPYGLIQGRIFWRVSPLQDFGPFWK 166 >XP_016499929.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana tabacum] XP_016499930.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana tabacum] Length = 169 Score = 69.7 bits (169), Expect = 1e-12 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFW 136 VP GHVWI+GDNKFN+ DSR FGPVPY +++GR+FW Sbjct: 118 VPNGHVWIEGDNKFNTTDSRKFGPVPYGLVQGRVFW 153 >XP_015063868.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Solanum pennellii] Length = 169 Score = 69.7 bits (169), Expect = 1e-12 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFW 136 VP GHVWI+GDNKFN+ DSR FGPVPY +++GR+FW Sbjct: 118 VPDGHVWIEGDNKFNTNDSRNFGPVPYGLVQGRVFW 153 >XP_009596099.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana tomentosiformis] XP_009596100.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana tomentosiformis] XP_018625018.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana tomentosiformis] Length = 169 Score = 69.7 bits (169), Expect = 1e-12 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFW 136 VP GHVWI+GDNKFN+ DSR FGPVPY +++GR+FW Sbjct: 118 VPNGHVWIEGDNKFNTTDSRKFGPVPYGLVQGRVFW 153 >XP_006365568.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Solanum tuberosum] Length = 169 Score = 69.7 bits (169), Expect = 1e-12 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFW 136 VP GHVWI+GDNKFN+ DSR FGPVPY +++GR+FW Sbjct: 118 VPDGHVWIEGDNKFNTNDSRNFGPVPYGLVQGRVFW 153 >XP_004233102.1 PREDICTED: mitochondrial inner membrane protease subunit 1 [Solanum lycopersicum] Length = 169 Score = 69.7 bits (169), Expect = 1e-12 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFW 136 VP GHVWI+GDNKFN+ DSR FGPVPY +++GR+FW Sbjct: 118 VPDGHVWIEGDNKFNTNDSRNFGPVPYGLVQGRVFW 153 >XP_013445098.1 inner membrane protease subunit 1 [Medicago truncatula] KEH19124.1 inner membrane protease subunit 1 [Medicago truncatula] Length = 162 Score = 69.3 bits (168), Expect = 2e-12 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWK 139 VPKGHVW++GDNKF+S DSR FGPVPY +IE +IFW+ Sbjct: 113 VPKGHVWVEGDNKFSSYDSRSFGPVPYGLIESKIFWR 149 >KYP36218.1 hypothetical protein KK1_042673, partial [Cajanus cajan] Length = 244 Score = 70.9 bits (172), Expect = 2e-12 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFWKFAAISFLRSF 169 VPKG VW++GDNK+NSRDSR FGPVPY +I+G++FWK ++ + F Sbjct: 195 VPKGGVWLEGDNKYNSRDSRTFGPVPYGLIQGKMFWKILPLNDIGPF 241 >XP_019226809.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana attenuata] XP_019226810.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana attenuata] XP_019226811.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana attenuata] XP_019226812.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana attenuata] OIT31805.1 chloroplast processing peptidase [Nicotiana attenuata] Length = 169 Score = 69.3 bits (168), Expect = 2e-12 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFW 136 VP GHVWI+GDNKFN+ DSR FGPVPY +++GR+FW Sbjct: 118 VPDGHVWIEGDNKFNTTDSRKFGPVPYGLVQGRVFW 153 >XP_009801823.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana sylvestris] XP_009801824.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana sylvestris] XP_016450869.1 PREDICTED: mitochondrial inner membrane protease subunit 1-like [Nicotiana tabacum] Length = 169 Score = 69.3 bits (168), Expect = 2e-12 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 29 VPKGHVWIQGDNKFNSRDSRYFGPVPYAMIEGRIFW 136 VP GHVWI+GDNKFN+ DSR FGPVPY +++GR+FW Sbjct: 118 VPDGHVWIEGDNKFNTTDSRKFGPVPYGLVQGRVFW 153