BLASTX nr result
ID: Angelica27_contig00002984
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00002984 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017236768.1 PREDICTED: ATP synthase subunit O, mitochondrial ... 75 3e-14 KZN05500.1 hypothetical protein DCAR_006337 [Daucus carota subsp... 57 2e-07 >XP_017236768.1 PREDICTED: ATP synthase subunit O, mitochondrial [Daucus carota subsp. sativus] Length = 240 Score = 75.1 bits (183), Expect = 3e-14 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 199 MASRLRSTLPLINKALTSSQPSSIPRVLSNPEVSRNFATTAAPKVTRRV 53 MASRLRS LPLIN+ALTSSQ SS+PR+L+NPEVSRNFAT AAP ++V Sbjct: 1 MASRLRSALPLINRALTSSQRSSVPRILANPEVSRNFATKAAPPKEKKV 49 >KZN05500.1 hypothetical protein DCAR_006337 [Daucus carota subsp. sativus] Length = 222 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 199 MASRLRSTLPLINKALTSSQPSSIPRVLSNPEV 101 MASRLRS LPLIN+ALTSSQ SS+PR+L+NPEV Sbjct: 1 MASRLRSALPLINRALTSSQRSSVPRILANPEV 33