BLASTX nr result
ID: Angelica27_contig00002981
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00002981 (431 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM90141.1 hypothetical protein DCAR_022494 [Daucus carota subsp... 51 3e-06 >KZM90141.1 hypothetical protein DCAR_022494 [Daucus carota subsp. sativus] Length = 54 Score = 51.2 bits (121), Expect = 3e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = -3 Query: 429 GFFTERKRHRKDSSNSTHMFSLSSDFSITTVGPR 328 GFFTERKRH KD S+S H+ S S+D+SIT + PR Sbjct: 21 GFFTERKRHEKDYSSSKHILSSSNDYSITAISPR 54