BLASTX nr result
ID: Angelica27_contig00002879
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00002879 (853 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244741.1 PREDICTED: classical arabinogalactan protein 10-l... 66 5e-10 >XP_017244741.1 PREDICTED: classical arabinogalactan protein 10-like [Daucus carota subsp. sativus] KZM98442.1 hypothetical protein DCAR_014196 [Daucus carota subsp. sativus] Length = 135 Score = 66.2 bits (160), Expect = 5e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 417 DDTPSGSFTDGWVHRAVIAGTAVTATCLSMALM 319 D++PSGSF DGWVHRAVIAGTAVTATCLSMALM Sbjct: 103 DESPSGSFADGWVHRAVIAGTAVTATCLSMALM 135