BLASTX nr result
ID: Angelica27_contig00002642
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00002642 (306 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017217807.1 PREDICTED: late embryogenesis abundant protein D-... 67 1e-10 AAB01096.1 a LEA protein, partial [Daucus carota] 56 7e-08 ACJ04787.1 LEA-3 protein [Bupleurum chinense] 55 7e-07 >XP_017217807.1 PREDICTED: late embryogenesis abundant protein D-29 [Daucus carota subsp. sativus] KZN09898.1 hypothetical protein DCAR_002554 [Daucus carota subsp. sativus] Length = 430 Score = 66.6 bits (161), Expect = 1e-10 Identities = 40/76 (52%), Positives = 45/76 (59%) Frame = +2 Query: 77 SHLTGEAKDKACETAEQAKQEAFKKGXXXXXXXXXXXXXXXXTAGVAKKTTMETANEAYN 256 S +TG+AKDKA E AE AK++A +KG TA AKK ANEAYN Sbjct: 319 SDITGKAKDKAYEAAENAKKKAEEKGNEAYEMSGKAKDKAYETAESAKKK----ANEAYN 374 Query: 257 KAGEKTEQAKEATEGN 304 GEK EQAKEATEGN Sbjct: 375 TVGEKAEQAKEATEGN 390 Score = 63.5 bits (153), Expect = 1e-09 Identities = 39/98 (39%), Positives = 43/98 (43%) Frame = +2 Query: 2 GEKADQAYKTXXXXXXXXXXXXXXXSHLTGEAKDKACETAEQAKQEAFKKGXXXXXXXXX 181 G+ D AYKT SHLTG+AKDKA ETAEQAKQEA +KG Sbjct: 149 GKAKDSAYKTAEEAKKVAAEKGEQASHLTGKAKDKAYETAEQAKQEALEKGKEAYEMTDK 208 Query: 182 XXXXXXXTAGVAKKTTMETANEAYNKAGEKTEQAKEAT 295 G AK E NEAY A A + T Sbjct: 209 AKDKAYDLTGKAKDKAAEKGNEAYEMASNAKHTAYDLT 246 >AAB01096.1 a LEA protein, partial [Daucus carota] Length = 136 Score = 56.2 bits (134), Expect = 7e-08 Identities = 40/101 (39%), Positives = 47/101 (46%) Frame = +2 Query: 2 GEKADQAYKTXXXXXXXXXXXXXXXSHLTGEAKDKACETAEQAKQEAFKKGXXXXXXXXX 181 G+ D+AY S +TG+AKDKA E AE+ EA++ Sbjct: 7 GKAKDKAYDLTGKAKDEAAEKANEASDITGKAKDKAYEAAEEKGNEAYEM-------TGK 59 Query: 182 XXXXXXXTAGVAKKTTMETANEAYNKAGEKTEQAKEATEGN 304 TA AKK ANEAY GEK EQAKEATEGN Sbjct: 60 AKDKAYETAESAKKK----ANEAYYTVGEKAEQAKEATEGN 96 >ACJ04787.1 LEA-3 protein [Bupleurum chinense] Length = 221 Score = 55.1 bits (131), Expect = 7e-07 Identities = 37/88 (42%), Positives = 41/88 (46%), Gaps = 18/88 (20%) Frame = +2 Query: 95 AKDKACETAE------------------QAKQEAFKKGXXXXXXXXXXXXXXXXTAGVAK 220 AKDKA ETAE +AK EA++ G TA AK Sbjct: 80 AKDKAYETAEAAKDKAYKTGSDAYDITGKAKDEAYEAGSEAYDATGKAKDKAYETAEGAK 139 Query: 221 KTTMETANEAYNKAGEKTEQAKEATEGN 304 K ETAN+AY K EK EQAKE TEGN Sbjct: 140 KKATETANDAYRKIEEKAEQAKETTEGN 167 Score = 53.1 bits (126), Expect = 3e-06 Identities = 31/74 (41%), Positives = 39/74 (52%) Frame = +2 Query: 77 SHLTGEAKDKACETAEQAKQEAFKKGXXXXXXXXXXXXXXXXTAGVAKKTTMETANEAYN 256 SH+T +AKDKA ETAEQAKQ+A +KG A AK++ E NEAY Sbjct: 16 SHMTEQAKDKAYETAEQAKQKASEKGNEENDTSKKAKDKANEPAEAAKQSAEEKRNEAYE 75 Query: 257 KAGEKTEQAKEATE 298 A ++A E E Sbjct: 76 AAEAAKDKAYETAE 89