BLASTX nr result
ID: Angelica27_contig00002112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00002112 (543 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AIB04244.1 chloroplast light harvesting chlorophyll a/b binding ... 161 9e-47 AIB04243.1 chloroplast light harvesting chlorophyll a/b binding ... 161 9e-47 ABF74606.1 chloroplast chlorophyll a/b-binding protein, partial ... 160 1e-46 ACI90636.1 chloroplast light harvesting chlorophyll a/b binding ... 161 1e-46 AAL04435.1 chlorophyll a/b binding protein, partial [Beta vulgaris] 158 2e-46 AAU89250.1 chloroplast light harvesting chlorophyll a/b binding ... 161 2e-46 ACI90635.1 chloroplast light harvesting chlorophyll a/b binding ... 161 3e-46 ACI90632.1 chloroplast light harvesting chlorophyll a/b binding ... 161 3e-46 AAU89252.1 chloroplast light harvesting chlorophyll a/b binding ... 161 3e-46 AAU89255.1 chloroplast light harvesting chlorophyll a/b binding ... 161 3e-46 AAU89254.1 chloroplast light harvesting chlorophyll a/b binding ... 161 3e-46 BAB41192.1 type I chlorophyll a/b-binding protein b, partial [Am... 157 3e-46 AFA36511.1 light harvesting chlorophyll a/b-binding protein Lhcb... 157 3e-46 AAO45885.1 chlorophyll a/b-binding protein precursor, partial [C... 159 3e-46 AAY81729.1 chloroplast putative light harvesting chlorophyll a/b... 160 4e-46 AAU89263.1 chloroplast light harvesting chlorophyll a/b binding ... 160 4e-46 AAU89265.1 chloroplast light harvesting chlorophyll a/b binding ... 160 4e-46 ACI90631.1 chloroplast light harvesting chlorophyll a/b binding ... 160 4e-46 AAU89261.1 chloroplast light harvesting chlorophyll a/b binding ... 160 4e-46 AAU89262.1 chloroplast light harvesting chlorophyll a/b binding ... 160 4e-46 >AIB04244.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus densata] AIB04245.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus massoniana] AIB04247.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus kesiya var. langbianensis] AIB04248.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus yunnanensis] Length = 219 Score = 161 bits (407), Expect = 9e-47 Identities = 76/79 (96%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 104 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 163 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 164 IAGGPLGEVTDPIYPGGSF 182 >AIB04243.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus yunnanensis var. tenuifolia] AIB04246.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus yunnanensis var. pygmaea] AIB04249.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus yunnanensis] Length = 219 Score = 161 bits (407), Expect = 9e-47 Identities = 76/79 (96%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 104 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 163 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 164 IAGGPLGEVTDPIYPGGSF 182 >ABF74606.1 chloroplast chlorophyll a/b-binding protein, partial [Agave tequilana] Length = 186 Score = 160 bits (404), Expect = 1e-46 Identities = 74/79 (93%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYR Sbjct: 37 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYR 96 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DP+YPGGSF Sbjct: 97 IAGGPLGEVTDPLYPGGSF 115 >ACI90636.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus massoniana] Length = 233 Score = 161 bits (407), Expect = 1e-46 Identities = 76/79 (96%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 106 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 165 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 166 IAGGPLGEVTDPIYPGGSF 184 >AAL04435.1 chlorophyll a/b binding protein, partial [Beta vulgaris] Length = 168 Score = 158 bits (400), Expect = 2e-46 Identities = 75/79 (94%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 41 ELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 100 Query: 362 VAGGPLGDVNDPIYPGGSF 306 VAGGPLG+V DP+YPGGSF Sbjct: 101 VAGGPLGEVVDPLYPGGSF 119 >AAU89250.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus echinata] Length = 253 Score = 161 bits (407), Expect = 2e-46 Identities = 76/79 (96%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 122 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 181 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 182 IAGGPLGEVTDPIYPGGSF 200 >ACI90635.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus yunnanensis] Length = 254 Score = 161 bits (407), Expect = 3e-46 Identities = 76/79 (96%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 127 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 186 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 187 IAGGPLGEVTDPIYPGGSF 205 >ACI90632.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus tabuliformis var. henryi] ACI90633.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus hwangshanensis] ACI90634.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus tabuliformis] Length = 254 Score = 161 bits (407), Expect = 3e-46 Identities = 76/79 (96%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 127 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 186 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 187 IAGGPLGEVTDPIYPGGSF 205 >AAU89252.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus radiata] Length = 256 Score = 161 bits (407), Expect = 3e-46 Identities = 76/79 (96%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 122 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 181 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 182 IAGGPLGEVTDPIYPGGSF 200 >AAU89255.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus roxburghii] Length = 256 Score = 161 bits (407), Expect = 3e-46 Identities = 76/79 (96%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 122 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 181 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 182 IAGGPLGEVTDPIYPGGSF 200 >AAU89254.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus merkusii] Length = 256 Score = 161 bits (407), Expect = 3e-46 Identities = 76/79 (96%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 122 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 181 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 182 IAGGPLGEVTDPIYPGGSF 200 >BAB41192.1 type I chlorophyll a/b-binding protein b, partial [Amaranthus tricolor] Length = 154 Score = 157 bits (398), Expect = 3e-46 Identities = 73/79 (92%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVILMGAVEGYR Sbjct: 41 ELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYR 100 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DP+YPGGSF Sbjct: 101 IAGGPLGEVVDPLYPGGSF 119 >AFA36511.1 light harvesting chlorophyll a/b-binding protein Lhcb1, partial [Lolium perenne] Length = 155 Score = 157 bits (398), Expect = 3e-46 Identities = 73/79 (92%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYR Sbjct: 6 ELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYR 65 Query: 362 VAGGPLGDVNDPIYPGGSF 306 VAGGPLG++ DP+YPGGSF Sbjct: 66 VAGGPLGEIVDPLYPGGSF 84 >AAO45885.1 chlorophyll a/b-binding protein precursor, partial [Citrus limon] Length = 216 Score = 159 bits (403), Expect = 3e-46 Identities = 73/79 (92%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR Sbjct: 115 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR 174 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DP+YPGGSF Sbjct: 175 IAGGPLGEVTDPLYPGGSF 193 >AAY81729.1 chloroplast putative light harvesting chlorophyll a/b binding protein, partial [Pinus gerardiana] Length = 253 Score = 160 bits (406), Expect = 4e-46 Identities = 75/79 (94%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVILMGAVEGYR Sbjct: 122 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYR 181 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 182 IAGGPLGEVTDPIYPGGSF 200 >AAU89263.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus longaeva] Length = 253 Score = 160 bits (406), Expect = 4e-46 Identities = 75/79 (94%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVILMGAVEGYR Sbjct: 119 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYR 178 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 179 IAGGPLGEVTDPIYPGGSF 197 >AAU89265.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Picea sitchensis] Length = 253 Score = 160 bits (406), Expect = 4e-46 Identities = 75/79 (94%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR Sbjct: 122 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 181 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG++ DPIYPGGSF Sbjct: 182 IAGGPLGEITDPIYPGGSF 200 >ACI90631.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus bungeana] Length = 254 Score = 160 bits (406), Expect = 4e-46 Identities = 75/79 (94%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVILMGAVEGYR Sbjct: 127 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYR 186 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 187 IAGGPLGEVTDPIYPGGSF 205 >AAU89261.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus monophylla] Length = 256 Score = 160 bits (406), Expect = 4e-46 Identities = 75/79 (94%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVILMGAVEGYR Sbjct: 122 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYR 181 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 182 IAGGPLGEVTDPIYPGGSF 200 >AAU89262.1 chloroplast light harvesting chlorophyll a/b binding protein, partial [Pinus remota] Length = 256 Score = 160 bits (406), Expect = 4e-46 Identities = 75/79 (94%), Positives = 78/79 (98%) Frame = -2 Query: 542 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR 363 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVILMGAVEGYR Sbjct: 122 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYR 181 Query: 362 VAGGPLGDVNDPIYPGGSF 306 +AGGPLG+V DPIYPGGSF Sbjct: 182 IAGGPLGEVTDPIYPGGSF 200