BLASTX nr result
ID: Angelica27_contig00001853
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00001853 (1021 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017214846.1 PREDICTED: classical arabinogalactan protein 9-li... 68 5e-10 >XP_017214846.1 PREDICTED: classical arabinogalactan protein 9-like [Daucus carota subsp. sativus] KZM90665.1 hypothetical protein DCAR_021970 [Daucus carota subsp. sativus] Length = 180 Score = 68.2 bits (165), Expect = 5e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 483 SAGDGSPAATPSSPDQSGAQNMMSMHKMVGSLGFG 379 SAGDGSPAATPSSPDQSGAQN+MSMHK +GSLG G Sbjct: 138 SAGDGSPAATPSSPDQSGAQNLMSMHKTIGSLGLG 172