BLASTX nr result
ID: Angelica27_contig00001821
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00001821 (565 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249920.1 PREDICTED: mitochondrial import receptor subunit ... 96 9e-23 XP_001758755.1 predicted protein [Physcomitrella patens] EDQ7626... 73 5e-14 WP_071414526.1 hypothetical protein [Acinetobacter baumannii] OI... 72 1e-13 XP_001764044.1 predicted protein [Physcomitrella patens] EDQ7118... 72 1e-13 KVI01446.1 Mitochondrial import receptor subunit TOM7 [Cynara ca... 72 1e-13 KVH88464.1 Mitochondrial import receptor subunit TOM7 [Cynara ca... 71 4e-13 ABK21382.1 unknown [Picea sitchensis] 71 4e-13 OIV93611.1 hypothetical protein TanjilG_04843 [Lupinus angustifo... 70 8e-13 XP_007225789.1 hypothetical protein PRUPE_ppa014339mg [Prunus pe... 70 8e-13 XP_011623506.1 PREDICTED: mitochondrial import receptor subunit ... 70 1e-12 XP_007160221.1 hypothetical protein PHAVU_002G303100g [Phaseolus... 70 1e-12 XP_009344055.1 PREDICTED: mitochondrial import receptor subunit ... 70 1e-12 XP_008341149.1 PREDICTED: mitochondrial import receptor subunit ... 70 1e-12 NP_001150221.1 mitochondrial import receptor subunit TOM7-1 [Zea... 70 1e-12 XP_014508006.1 PREDICTED: mitochondrial import receptor subunit ... 69 2e-12 XP_002458194.1 hypothetical protein SORBIDRAFT_03g028510 [Sorghu... 69 2e-12 XP_017410704.1 PREDICTED: mitochondrial import receptor subunit ... 69 2e-12 XP_009370016.1 PREDICTED: mitochondrial import receptor subunit ... 69 2e-12 XP_018808464.1 PREDICTED: mitochondrial import receptor subunit ... 69 2e-12 XP_015080898.1 PREDICTED: mitochondrial import receptor subunit ... 69 2e-12 >XP_017249920.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Daucus carota subsp. sativus] KZM96550.1 hypothetical protein DCAR_019792 [Daucus carota subsp. sativus] Length = 79 Score = 95.9 bits (237), Expect = 9e-23 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 DMEIPKPLKEWPTWFLKKAKVV H+GFIPLIIV+GMNT+PKPSIAQ Sbjct: 29 DMEIPKPLKEWPTWFLKKAKVVAHYGFIPLIIVIGMNTDPKPSIAQ 74 >XP_001758755.1 predicted protein [Physcomitrella patens] EDQ76261.1 predicted protein [Physcomitrella patens] Length = 56 Score = 72.8 bits (177), Expect = 5e-14 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -3 Query: 305 KPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 K +KEWPTW LKKAK V H+GFIPLII +GMNTEPKP ++Q Sbjct: 11 KLIKEWPTWILKKAKTVTHYGFIPLIIFIGMNTEPKPQLSQ 51 >WP_071414526.1 hypothetical protein [Acinetobacter baumannii] OIC55337.1 hypothetical protein A7L55_19325 [Acinetobacter baumannii] Length = 72 Score = 72.4 bits (176), Expect = 1e-13 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = -3 Query: 305 KPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 K +KEW TW +KKAK+V H+GFIP++I++GMN+EPKPSIAQ Sbjct: 27 KSVKEWTTWVMKKAKIVTHYGFIPMVIIIGMNSEPKPSIAQ 67 >XP_001764044.1 predicted protein [Physcomitrella patens] EDQ71183.1 predicted protein [Physcomitrella patens] Length = 56 Score = 71.6 bits (174), Expect = 1e-13 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -3 Query: 305 KPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 K +KEWPTW LKKAK V H+GFIPLII +GMNT+PKP ++Q Sbjct: 11 KLIKEWPTWILKKAKTVTHYGFIPLIIFIGMNTDPKPQLSQ 51 >KVI01446.1 Mitochondrial import receptor subunit TOM7 [Cynara cardunculus var. scolymus] Length = 72 Score = 72.0 bits (175), Expect = 1e-13 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 D K LKEW TW +KKAKV+ H+GFIPLII++GMN++PKPSI+Q Sbjct: 22 DNSTSKLLKEWSTWTIKKAKVITHYGFIPLIIIIGMNSDPKPSISQ 67 >KVH88464.1 Mitochondrial import receptor subunit TOM7 [Cynara cardunculus var. scolymus] Length = 72 Score = 70.9 bits (172), Expect = 4e-13 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 D K KEW TW +KKAKV+ H+GFIPLIIV+GMN++PKPSI+Q Sbjct: 22 DNSTSKLFKEWSTWTIKKAKVITHYGFIPLIIVIGMNSDPKPSISQ 67 >ABK21382.1 unknown [Picea sitchensis] Length = 72 Score = 70.9 bits (172), Expect = 4e-13 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -3 Query: 305 KPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 K +KEW TW +K+AK V H+GFIPL+I++GMN+EPKPSIAQ Sbjct: 27 KAVKEWTTWVMKRAKTVTHYGFIPLVIIIGMNSEPKPSIAQ 67 >OIV93611.1 hypothetical protein TanjilG_04843 [Lupinus angustifolius] Length = 72 Score = 70.1 bits (170), Expect = 8e-13 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 D I + +KEW TW L+KAKV+ H+GFIPL+I+VGMN++PKP I+Q Sbjct: 22 DRTISESVKEWSTWALRKAKVITHYGFIPLVIIVGMNSDPKPQISQ 67 >XP_007225789.1 hypothetical protein PRUPE_ppa014339mg [Prunus persica] XP_008223958.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Prunus mume] ONI27067.1 hypothetical protein PRUPE_1G065700 [Prunus persica] Length = 73 Score = 70.1 bits (170), Expect = 8e-13 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 + + + +KEW TW +KKAKVV H+GFIPLIIV+GMN+EPKP ++Q Sbjct: 23 ERSVAQSVKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQ 68 >XP_011623506.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Amborella trichopoda] Length = 71 Score = 69.7 bits (169), Expect = 1e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -3 Query: 305 KPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 K +KEW TW LKKAKVV H+GFIPLIIV+GMN+EPKP ++Q Sbjct: 26 KCVKEWSTWTLKKAKVVAHYGFIPLIIVIGMNSEPKPYLSQ 66 >XP_007160221.1 hypothetical protein PHAVU_002G303100g [Phaseolus vulgaris] ESW32215.1 hypothetical protein PHAVU_002G303100g [Phaseolus vulgaris] Length = 72 Score = 69.7 bits (169), Expect = 1e-12 Identities = 25/46 (54%), Positives = 39/46 (84%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 D + + LKEW TW ++KAKV+ H+GFIPL+I++GMN++PKP+++Q Sbjct: 22 DRSVSESLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSDPKPALSQ 67 >XP_009344055.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 69.7 bits (169), Expect = 1e-12 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 + + + KEW TW LKKAKVV H+GFIPL+I++GMN+EPKP ++Q Sbjct: 23 ERSVAQSFKEWSTWALKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQ 68 >XP_008341149.1 PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Malus domestica] XP_018497783.1 PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Pyrus x bretschneideri] Length = 73 Score = 69.7 bits (169), Expect = 1e-12 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 + + + KEW TW LKKAKVV H+GFIPL+I++GMN+EPKP ++Q Sbjct: 23 ERSVAQSFKEWSTWALKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQ 68 >NP_001150221.1 mitochondrial import receptor subunit TOM7-1 [Zea mays] ACG25096.1 mitochondrial import receptor subunit TOM7-1 [Zea mays] ACG38287.1 mitochondrial import receptor subunit TOM7-1 [Zea mays] ACG48892.1 mitochondrial import receptor subunit TOM7-1 [Zea mays] ACN26925.1 unknown [Zea mays] AQK96811.1 Mitochondrial import receptor subunit TOM7-1 [Zea mays] Length = 79 Score = 69.7 bits (169), Expect = 1e-12 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -3 Query: 299 LKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 +KEW TW +KKAKVV H+GFIPL+IV+GMN+EPKPS+ Q Sbjct: 36 MKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQ 74 >XP_014508006.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Vigna radiata var. radiata] Length = 72 Score = 69.3 bits (168), Expect = 2e-12 Identities = 25/46 (54%), Positives = 39/46 (84%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 D + + LKEW TW ++KAKV+ H+GFIPL+I++GMN++PKP+++Q Sbjct: 22 DRSLSESLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSDPKPALSQ 67 >XP_002458194.1 hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] EES03314.1 hypothetical protein SORBI_003G227200 [Sorghum bicolor] Length = 79 Score = 69.3 bits (168), Expect = 2e-12 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -3 Query: 299 LKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 +KEW TW +KKAKVV H+GFIPL+IV+GMN+EPKPS+ Q Sbjct: 36 VKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQ 74 >XP_017410704.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform X1 [Vigna angularis] XP_017410705.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform X2 [Vigna angularis] Length = 72 Score = 68.9 bits (167), Expect = 2e-12 Identities = 25/46 (54%), Positives = 39/46 (84%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 D + + LKEW TW ++KAKV+ H+GFIPL+I++GMN++PKP+++Q Sbjct: 22 DRSVCESLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSDPKPALSQ 67 >XP_009370016.1 PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Pyrus x bretschneideri] Length = 73 Score = 68.9 bits (167), Expect = 2e-12 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -3 Query: 320 DMEIPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 + + + KEW TW LKKAKVV H+GFIP++I++GMN+EPKP ++Q Sbjct: 23 ERSVAQSFKEWSTWALKKAKVVTHYGFIPMVIIIGMNSEPKPQLSQ 68 >XP_018808464.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Juglans regia] Length = 74 Score = 68.9 bits (167), Expect = 2e-12 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -3 Query: 299 LKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 LKEW TW +KKAKV+ H+GFIPLII++GMN+EPKP ++Q Sbjct: 31 LKEWSTWAVKKAKVITHYGFIPLIIIIGMNSEPKPQLSQ 69 >XP_015080898.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Solanum pennellii] XP_015080901.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Solanum pennellii] Length = 77 Score = 68.9 bits (167), Expect = 2e-12 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = -3 Query: 311 IPKPLKEWPTWFLKKAKVVVHFGFIPLIIVVGMNTEPKPSIAQ 183 + K +KEW TW KKAKVV H+GFIPL+I++GMN+EPKPS++Q Sbjct: 30 VGKFVKEWGTWTAKKAKVVTHYGFIPLVIIIGMNSEPKPSLSQ 72