BLASTX nr result
ID: Angelica27_contig00001660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00001660 (875 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215940.1 PREDICTED: lysine-rich arabinogalactan protein 18... 59 1e-06 >XP_017215940.1 PREDICTED: lysine-rich arabinogalactan protein 18 [Daucus carota subsp. sativus] KZM88697.1 hypothetical protein DCAR_025772 [Daucus carota subsp. sativus] Length = 205 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 388 LADESGAESLKCVQKIVGSLVLGWALFGMVF 480 LADESGAESLK VQKIVGSLVLGWA+FGM+F Sbjct: 175 LADESGAESLKSVQKIVGSLVLGWAVFGMLF 205