BLASTX nr result
ID: Angelica27_contig00001641
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00001641 (448 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN01192.1 hypothetical protein DCAR_009946 [Daucus carota subsp... 54 4e-07 XP_017243185.1 PREDICTED: truncated transcription factor CAULIFL... 54 7e-06 >KZN01192.1 hypothetical protein DCAR_009946 [Daucus carota subsp. sativus] Length = 56 Score = 53.9 bits (128), Expect = 4e-07 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = -2 Query: 447 QIAAMEKENQAANEKDKNREGDINLPNRSDNETNPSPLQQTLMLLF 310 +I AMEKEN A E+D NRE ++ N +DNET+ SP QQTL LLF Sbjct: 10 KITAMEKENTDAKERDDNREVNLEFHNLADNETDRSPPQQTLSLLF 55 >XP_017243185.1 PREDICTED: truncated transcription factor CAULIFLOWER D-like [Daucus carota subsp. sativus] Length = 219 Score = 53.9 bits (128), Expect = 7e-06 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = -2 Query: 447 QIAAMEKENQAANEKDKNREGDINLPNRSDNETNPSPLQQTLMLLF 310 +I AMEKEN A E+D NRE ++ N +DNET+ SP QQTL LLF Sbjct: 173 KITAMEKENTDAKERDDNREVNLEFHNLADNETDRSPPQQTLSLLF 218