BLASTX nr result
ID: Angelica27_contig00001507
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00001507 (385 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017250501.1 PREDICTED: auxin-induced protein 22A-like [Daucus... 118 3e-31 >XP_017250501.1 PREDICTED: auxin-induced protein 22A-like [Daucus carota subsp. sativus] KZM94555.1 hypothetical protein DCAR_017798 [Daucus carota subsp. sativus] Length = 174 Score = 118 bits (295), Expect = 3e-31 Identities = 59/85 (69%), Positives = 67/85 (78%) Frame = -1 Query: 256 MELQLGLALLPNINKFEMNKESTSESEPPKDVYGSVHSLQAKKRDFNEAFDHEDSFLGTT 77 MELQLGLAL P+INKFEMNKESTSE P +D+YGS H+L KR+FNEAFD DSF+ TT Sbjct: 1 MELQLGLALFPDINKFEMNKESTSE--PQRDMYGSGHTLHPNKRNFNEAFDRHDSFVSTT 58 Query: 76 DDIPQTLALFSWDNGLTKNGIQDTK 2 DDIP+TLALFSWDN K +D K Sbjct: 59 DDIPRTLALFSWDNDDAKKDGEDVK 83