BLASTX nr result
ID: Angelica27_contig00000664
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00000664 (436 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017255018.1 PREDICTED: autophagy-related protein 8C [Daucus c... 129 3e-36 XP_011461042.1 PREDICTED: autophagy-related protein 8C [Fragaria... 129 5e-36 OAY28486.1 hypothetical protein MANES_15G070700 [Manihot esculenta] 129 6e-36 XP_012849229.1 PREDICTED: autophagy-related protein 8C-like [Ery... 129 7e-36 XP_002279664.1 PREDICTED: autophagy-related protein 8C [Vitis vi... 128 1e-35 XP_018811709.1 PREDICTED: autophagy-related protein 8C [Juglans ... 128 1e-35 XP_011097865.1 PREDICTED: autophagy-related protein 8C [Sesamum ... 128 1e-35 EPS73704.1 autophagy 8a, partial [Genlisea aurea] 128 1e-35 XP_006452386.1 hypothetical protein CICLE_v10009926mg [Citrus cl... 128 1e-35 OIW05952.1 hypothetical protein TanjilG_07228 [Lupinus angustifo... 127 2e-35 EYU27346.1 hypothetical protein MIMGU_mgv1a015712mg [Erythranthe... 129 2e-35 XP_002529905.1 PREDICTED: autophagy-related protein 8C [Ricinus ... 128 2e-35 OAY55140.1 hypothetical protein MANES_03G130800, partial [Maniho... 127 2e-35 KZV56399.1 autophagy-related protein 8C [Dorcoceras hygrometricum] 129 2e-35 XP_007213980.1 hypothetical protein PRUPE_ppa013540mg [Prunus pe... 127 2e-35 XP_010276124.1 PREDICTED: autophagy-related protein 8C-like isof... 127 2e-35 XP_019451216.1 PREDICTED: autophagy-related protein 8C-like [Lup... 127 2e-35 XP_002529904.1 PREDICTED: autophagy-related protein 8C [Ricinus ... 127 2e-35 EPS63017.1 autophagy 8a, partial [Genlisea aurea] 127 3e-35 XP_010278666.1 PREDICTED: autophagy-related protein 8C isoform X... 127 3e-35 >XP_017255018.1 PREDICTED: autophagy-related protein 8C [Daucus carota subsp. sativus] KZM90065.1 hypothetical protein DCAR_022570 [Daucus carota subsp. sativus] Length = 119 Score = 129 bits (325), Expect = 3e-36 Identities = 64/65 (98%), Positives = 65/65 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFGSD 242 TFGS+ Sbjct: 115 TFGSN 119 >XP_011461042.1 PREDICTED: autophagy-related protein 8C [Fragaria vesca subsp. vesca] Length = 119 Score = 129 bits (324), Expect = 5e-36 Identities = 64/64 (100%), Positives = 64/64 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFGS 245 TFGS Sbjct: 115 TFGS 118 >OAY28486.1 hypothetical protein MANES_15G070700 [Manihot esculenta] Length = 125 Score = 129 bits (324), Expect = 6e-36 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKN+LPPTAAMMSAIYEENKD+DGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNVLPPTAAMMSAIYEENKDDDGFLYMTYSGEN 114 Query: 256 TFGSD*KDFQS 224 TFG+ K + S Sbjct: 115 TFGASVKGYSS 125 >XP_012849229.1 PREDICTED: autophagy-related protein 8C-like [Erythranthe guttata] EYU27347.1 hypothetical protein MIMGU_mgv1a015712mg [Erythranthe guttata] Length = 120 Score = 129 bits (323), Expect = 7e-36 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMS+IYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSSIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFGSD 242 TFGS+ Sbjct: 115 TFGSE 119 >XP_002279664.1 PREDICTED: autophagy-related protein 8C [Vitis vinifera] CBI26649.3 unnamed protein product, partial [Vitis vinifera] Length = 119 Score = 128 bits (322), Expect = 1e-35 Identities = 62/64 (96%), Positives = 64/64 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYV+RKRIKLSAEKAIFIFVKN+LPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVIRKRIKLSAEKAIFIFVKNVLPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFGS 245 TFGS Sbjct: 115 TFGS 118 >XP_018811709.1 PREDICTED: autophagy-related protein 8C [Juglans regia] Length = 119 Score = 128 bits (321), Expect = 1e-35 Identities = 63/64 (98%), Positives = 64/64 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFGS 245 TFG+ Sbjct: 115 TFGT 118 >XP_011097865.1 PREDICTED: autophagy-related protein 8C [Sesamum indicum] Length = 119 Score = 128 bits (321), Expect = 1e-35 Identities = 63/64 (98%), Positives = 64/64 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIY+ENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYDENKDEDGFLYMTYSGEN 114 Query: 256 TFGS 245 TFGS Sbjct: 115 TFGS 118 >EPS73704.1 autophagy 8a, partial [Genlisea aurea] Length = 119 Score = 128 bits (321), Expect = 1e-35 Identities = 63/64 (98%), Positives = 64/64 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKD+DGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDDDGFLYMTYSGEN 114 Query: 256 TFGS 245 TFGS Sbjct: 115 TFGS 118 >XP_006452386.1 hypothetical protein CICLE_v10009926mg [Citrus clementina] XP_006452387.1 hypothetical protein CICLE_v10009926mg [Citrus clementina] XP_006452388.1 hypothetical protein CICLE_v10009926mg [Citrus clementina] XP_006452389.1 hypothetical protein CICLE_v10009926mg [Citrus clementina] XP_006452390.1 hypothetical protein CICLE_v10009926mg [Citrus clementina] XP_006475051.1 PREDICTED: autophagy-related protein 8C [Citrus sinensis] XP_006475052.1 PREDICTED: autophagy-related protein 8C [Citrus sinensis] XP_006475053.1 PREDICTED: autophagy-related protein 8C [Citrus sinensis] XP_006475054.1 PREDICTED: autophagy-related protein 8C [Citrus sinensis] ESR65626.1 hypothetical protein CICLE_v10009926mg [Citrus clementina] ESR65627.1 hypothetical protein CICLE_v10009926mg [Citrus clementina] ESR65628.1 hypothetical protein CICLE_v10009926mg [Citrus clementina] ESR65629.1 hypothetical protein CICLE_v10009926mg [Citrus clementina] ESR65630.1 hypothetical protein CICLE_v10009926mg [Citrus clementina] KDO62744.1 hypothetical protein CISIN_1g033381mg [Citrus sinensis] Length = 120 Score = 128 bits (321), Expect = 1e-35 Identities = 63/64 (98%), Positives = 64/64 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFGS 245 TFG+ Sbjct: 115 TFGA 118 >OIW05952.1 hypothetical protein TanjilG_07228 [Lupinus angustifolius] Length = 110 Score = 127 bits (320), Expect = 2e-35 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 45 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 104 Query: 256 TFG 248 TFG Sbjct: 105 TFG 107 >EYU27346.1 hypothetical protein MIMGU_mgv1a015712mg [Erythranthe guttata] Length = 148 Score = 129 bits (323), Expect = 2e-35 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMS+IYEENKDEDGFLYMTYSGEN Sbjct: 83 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSSIYEENKDEDGFLYMTYSGEN 142 Query: 256 TFGSD 242 TFGS+ Sbjct: 143 TFGSE 147 >XP_002529905.1 PREDICTED: autophagy-related protein 8C [Ricinus communis] EEF32459.1 gaba(A) receptor-associated protein, putative [Ricinus communis] Length = 125 Score = 128 bits (321), Expect = 2e-35 Identities = 63/64 (98%), Positives = 64/64 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFGS 245 TFG+ Sbjct: 115 TFGA 118 >OAY55140.1 hypothetical protein MANES_03G130800, partial [Manihot esculenta] Length = 102 Score = 127 bits (319), Expect = 2e-35 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKN+LPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 38 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNVLPPTAAMMSAIYEENKDEDGFLYMTYSGEN 97 Query: 256 TFG 248 TFG Sbjct: 98 TFG 100 >KZV56399.1 autophagy-related protein 8C [Dorcoceras hygrometricum] Length = 164 Score = 129 bits (324), Expect = 2e-35 Identities = 64/64 (100%), Positives = 64/64 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 100 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 159 Query: 256 TFGS 245 TFGS Sbjct: 160 TFGS 163 >XP_007213980.1 hypothetical protein PRUPE_ppa013540mg [Prunus persica] XP_007213981.1 hypothetical protein PRUPE_ppa013540mg [Prunus persica] XP_008226882.1 PREDICTED: autophagy-related protein 8C [Prunus mume] XP_008364911.1 PREDICTED: autophagy-related protein 8C [Malus domestica] XP_008364918.1 PREDICTED: autophagy-related protein 8C [Malus domestica] XP_008364925.1 PREDICTED: autophagy-related protein 8C [Malus domestica] XP_009361003.1 PREDICTED: autophagy-related protein 8C [Pyrus x bretschneideri] XP_009361004.1 PREDICTED: autophagy-related protein 8C [Pyrus x bretschneideri] XP_018503970.1 PREDICTED: autophagy-related protein 8C [Pyrus x bretschneideri] ONI13321.1 hypothetical protein PRUPE_4G215300 [Prunus persica] Length = 117 Score = 127 bits (320), Expect = 2e-35 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFG 248 TFG Sbjct: 115 TFG 117 >XP_010276124.1 PREDICTED: autophagy-related protein 8C-like isoform X2 [Nelumbo nucifera] XP_010276125.1 PREDICTED: autophagy-related protein 8C-like isoform X2 [Nelumbo nucifera] Length = 118 Score = 127 bits (320), Expect = 2e-35 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFG 248 TFG Sbjct: 115 TFG 117 >XP_019451216.1 PREDICTED: autophagy-related protein 8C-like [Lupinus angustifolius] XP_019451217.1 PREDICTED: autophagy-related protein 8C-like [Lupinus angustifolius] Length = 120 Score = 127 bits (320), Expect = 2e-35 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFG 248 TFG Sbjct: 115 TFG 117 >XP_002529904.1 PREDICTED: autophagy-related protein 8C [Ricinus communis] XP_012070846.1 PREDICTED: autophagy-related protein 8C-like [Jatropha curcas] EEF32458.1 gaba(A) receptor-associated protein, putative [Ricinus communis] Length = 120 Score = 127 bits (320), Expect = 2e-35 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFG 248 TFG Sbjct: 115 TFG 117 >EPS63017.1 autophagy 8a, partial [Genlisea aurea] Length = 117 Score = 127 bits (319), Expect = 3e-35 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKN+LPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNVLPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFG 248 TFG Sbjct: 115 TFG 117 >XP_010278666.1 PREDICTED: autophagy-related protein 8C isoform X2 [Nelumbo nucifera] XP_019055898.1 PREDICTED: autophagy-related protein 8C isoform X2 [Nelumbo nucifera] Length = 118 Score = 127 bits (319), Expect = 3e-35 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -1 Query: 436 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGEN 257 DLTVGQFVYVVRKRIKLSAEKAIFIFVKN+LPPTAAMMSAIYEENKDEDGFLYMTYSGEN Sbjct: 55 DLTVGQFVYVVRKRIKLSAEKAIFIFVKNVLPPTAAMMSAIYEENKDEDGFLYMTYSGEN 114 Query: 256 TFG 248 TFG Sbjct: 115 TFG 117