BLASTX nr result
ID: Angelica27_contig00000099
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00000099 (709 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN04537.1 hypothetical protein DCAR_005374 [Daucus carota subsp... 67 6e-11 >KZN04537.1 hypothetical protein DCAR_005374 [Daucus carota subsp. sativus] Length = 110 Score = 67.4 bits (163), Expect = 6e-11 Identities = 35/56 (62%), Positives = 45/56 (80%), Gaps = 2/56 (3%) Frame = -1 Query: 538 MENIPEDEHMDVHK-GLEENDES-APKTRNVPFITALNIVFLVSYFSLSPDEGLSL 377 MENIPEDEH+++H+ GLEENDES + +++ PF+ LN+V LVSY SLS DE LSL Sbjct: 1 MENIPEDEHVNLHEEGLEENDESVSSNSQDFPFLAGLNLVLLVSYLSLSEDECLSL 56