BLASTX nr result
ID: Angelica23_contig00037953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00037953 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137762.1| PREDICTED: L-type lectin-domain containing r... 60 2e-07 >ref|XP_004137762.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like [Cucumis sativus] gi|449524894|ref|XP_004169456.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like [Cucumis sativus] Length = 683 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/68 (42%), Positives = 43/68 (63%) Frame = -3 Query: 394 EIVRYLEGQMGLPDVVTRPGGYPDRRAMEGFNNLLGLYPSSSFENGSGYSLGRNEDAGLR 215 ++VR+LEG+MG+P+ ++ P R EGF++ + + SSSF S YS N+D + Sbjct: 608 QVVRFLEGEMGVPEEISAPKVMEGGRNGEGFDDFVNSFASSSFNKFSSYSSTGNKDMDMS 667 Query: 214 FASISTSP 191 FAS STSP Sbjct: 668 FASFSTSP 675