BLASTX nr result
ID: Angelica23_contig00037381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00037381 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containi... 113 1e-23 ref|XP_002518527.1| pentatricopeptide repeat-containing protein,... 112 2e-23 ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|2... 106 2e-21 gb|AFV70833.1| tetratricopeptide repeat-like superfamily protein... 72 5e-11 gb|AFV70822.1| tetratricopeptide repeat-like superfamily protein... 70 2e-10 >ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170-like [Vitis vinifera] Length = 569 Score = 113 bits (283), Expect = 1e-23 Identities = 55/85 (64%), Positives = 64/85 (75%) Frame = +1 Query: 28 FSSLTKTKTSSNWRTQIKQTHLVSQISSILLQRTNWPHLLLSLNFSTKLTPYLFLQIIHK 207 F+ +K+ T NWR QIKQ L+SQISSILLQR NW LL + N S+KLTP LF QI+ K Sbjct: 10 FNQFSKSTTPLNWRAQIKQNQLISQISSILLQRHNWVTLLRNFNLSSKLTPSLFHQILLK 69 Query: 208 TQSNPQISLNFFNWAKKNLGFQPDL 282 TQ NPQ SL+FFNW + NLGFQPDL Sbjct: 70 TQKNPQSSLSFFNWVRTNLGFQPDL 94 >ref|XP_002518527.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542372|gb|EEF43914.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 599 Score = 112 bits (281), Expect = 2e-23 Identities = 56/89 (62%), Positives = 68/89 (76%), Gaps = 1/89 (1%) Frame = +1 Query: 22 LPFSSLTKTKTSS-NWRTQIKQTHLVSQISSILLQRTNWPHLLLSLNFSTKLTPYLFLQI 198 L F T TS +WRT+I+Q LVS+IS+ILLQR NW LL +LN S+KLTP+LF QI Sbjct: 28 LLFRKTYSTSTSKISWRTRIQQNQLVSEISTILLQRNNWIPLLQNLNLSSKLTPFLFFQI 87 Query: 199 IHKTQSNPQISLNFFNWAKKNLGFQPDLR 285 +HKTQ++ QISLNFFNWAK NL F PDL+ Sbjct: 88 LHKTQTHAQISLNFFNWAKTNLNFNPDLK 116 >ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|222848569|gb|EEE86116.1| predicted protein [Populus trichocarpa] Length = 564 Score = 106 bits (265), Expect = 2e-21 Identities = 52/78 (66%), Positives = 59/78 (75%) Frame = +1 Query: 52 TSSNWRTQIKQTHLVSQISSILLQRTNWPHLLLSLNFSTKLTPYLFLQIIHKTQSNPQIS 231 TS WR QI+Q LV QISSILLQR NW LL + N STKLTP LF QI+HKTQ+NPQIS Sbjct: 10 TSMKWRIQIRQNQLVFQISSILLQRHNWVSLLQNFNLSTKLTPPLFNQILHKTQTNPQIS 69 Query: 232 LNFFNWAKKNLGFQPDLR 285 L FFNW + NL +PDL+ Sbjct: 70 LRFFNWVQTNLKLKPDLK 87 >gb|AFV70833.1| tetratricopeptide repeat-like superfamily protein, partial [Arabidopsis halleri] Length = 186 Score = 72.0 bits (175), Expect = 5e-11 Identities = 39/89 (43%), Positives = 59/89 (66%), Gaps = 4/89 (4%) Frame = +1 Query: 31 SSLTKTKTSSNWRTQIKQTHLVSQISSILLQRTNW----PHLLLSLNFSTKLTPYLFLQI 198 S+ T ++SNW+TQ L + ISSILLQR NW P++ L+ ST +P +FLQI Sbjct: 4 SATPSTSSASNWKTQQTLFRLATDISSILLQRRNWITHLPYVKSKLSRSTLTSP-IFLQI 62 Query: 199 IHKTQSNPQISLNFFNWAKKNLGFQPDLR 285 + +T+ P+ +L+FF++AK +L F PDL+ Sbjct: 63 LRETRKCPKTTLDFFDFAKTHLRFDPDLK 91 >gb|AFV70822.1| tetratricopeptide repeat-like superfamily protein, partial [Arabidopsis halleri] Length = 186 Score = 69.7 bits (169), Expect = 2e-10 Identities = 38/89 (42%), Positives = 59/89 (66%), Gaps = 4/89 (4%) Frame = +1 Query: 31 SSLTKTKTSSNWRTQIKQTHLVSQISSILLQRTNW----PHLLLSLNFSTKLTPYLFLQI 198 S+ T ++SNW+TQ L ++ISSILLQR NW ++ L+ ST +P +FLQI Sbjct: 4 SATPSTSSASNWKTQQTLFRLATEISSILLQRRNWITHLQYVKSKLSRSTLTSP-IFLQI 62 Query: 199 IHKTQSNPQISLNFFNWAKKNLGFQPDLR 285 + +T+ P+ +L+FF++AK +L F PDL+ Sbjct: 63 LRETRKCPKTTLDFFDFAKTHLRFDPDLK 91