BLASTX nr result
ID: Angelica23_contig00033670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00033670 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524154.1| PREDICTED: CBL-interacting serine/threonine-... 56 3e-06 ref|XP_003607806.1| hypothetical protein MTR_4g083110 [Medicago ... 56 3e-06 >ref|XP_003524154.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 23-like [Glycine max] Length = 621 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +3 Query: 3 EVAPPQIVSVMRNRTSKILDTINEDDREISVNDSHM 110 EVAPPQ V+VMR+RTSK+LDTI ED+REIS +DS M Sbjct: 12 EVAPPQYVTVMRHRTSKMLDTITEDEREISTSDSVM 47 >ref|XP_003607806.1| hypothetical protein MTR_4g083110 [Medicago truncatula] gi|355508861|gb|AES90003.1| hypothetical protein MTR_4g083110 [Medicago truncatula] Length = 85 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 3 EVAPPQIVSVMRNRTSKILDTINEDDREISVNDS 104 EVAPPQ VSVMR+RTSK+++TI EDDREI+ NDS Sbjct: 12 EVAPPQYVSVMRHRTSKMMETITEDDREINSNDS 45