BLASTX nr result
ID: Angelica23_contig00030528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00030528 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64497.1| hypothetical protein VITISV_004037 [Vitis vinifera] 57 2e-06 ref|XP_003609657.1| hypothetical protein MTR_4g119630 [Medicago ... 55 5e-06 >emb|CAN64497.1| hypothetical protein VITISV_004037 [Vitis vinifera] Length = 480 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +2 Query: 86 RSHVMSTKRTILSPFTKEYRVLVTYSGIRLFLEGSS 193 RS +STKRTILSPFTKEYRV SGIRLFLEG+S Sbjct: 16 RSRAVSTKRTILSPFTKEYRVRAASSGIRLFLEGAS 51 >ref|XP_003609657.1| hypothetical protein MTR_4g119630 [Medicago truncatula] gi|355510712|gb|AES91854.1| hypothetical protein MTR_4g119630 [Medicago truncatula] Length = 505 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 192 EDPSKNRRMPL*VTSTRYSLVKGERIVRFVLITWLR 85 ++PSKN R+PL VT TRYSLVKGERIVRFVLIT R Sbjct: 467 KNPSKNMRIPLKVTRTRYSLVKGERIVRFVLITRFR 502