BLASTX nr result
ID: Angelica23_contig00008833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00008833 (496 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274427.1| PREDICTED: pentatricopeptide repeat-containi... 89 3e-16 ref|XP_003602717.1| Pentatricopeptide repeat-containing protein ... 72 6e-11 ref|XP_003597244.1| Pentatricopeptide repeat protein [Medicago t... 72 6e-11 ref|XP_002300388.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_002870024.1| pentatricopeptide repeat-containing protein ... 71 1e-10 >ref|XP_002274427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g52850, chloroplastic [Vitis vinifera] gi|302143764|emb|CBI22625.3| unnamed protein product [Vitis vinifera] Length = 880 Score = 89.4 bits (220), Expect = 3e-16 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = +2 Query: 2 KNIRICKDCHDFMVHLTLLVHREIIIRDGNRFHCFKKGECSCRGFW 139 KNIRIC+DCHDF++++T LV REII+RDGNRFH FKKGECSCRG+W Sbjct: 835 KNIRICRDCHDFIMNVTRLVDREIIVRDGNRFHSFKKGECSCRGYW 880 >ref|XP_003602717.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355491765|gb|AES72968.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 554 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +2 Query: 2 KNIRICKDCHDFMVHLTLLVHREIIIRDGNRFHCFKKGECSCRGFW 139 KN+RIC DCHDFM H + + R+IIIRD NRFH F KG CSC+ FW Sbjct: 509 KNLRICYDCHDFMKHASGIFDRDIIIRDRNRFHHFSKGLCSCQDFW 554 >ref|XP_003597244.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355486292|gb|AES67495.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 678 Score = 71.6 bits (174), Expect = 6e-11 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +2 Query: 2 KNIRICKDCHDFMVHLTLLVHREIIIRDGNRFHCFKKGECSCRGFW 139 KN+R+C DCH+ + H++ + REI+IRD NRFHCF G CSCR +W Sbjct: 633 KNLRVCGDCHEAIKHISKVTGREIVIRDNNRFHCFSDGACSCRDYW 678 >ref|XP_002300388.1| predicted protein [Populus trichocarpa] gi|222847646|gb|EEE85193.1| predicted protein [Populus trichocarpa] Length = 514 Score = 71.2 bits (173), Expect = 8e-11 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +2 Query: 2 KNIRICKDCHDFMVHLTLLVHREIIIRDGNRFHCFKKGECSCRGFW 139 KN+R+C+DCH + ++ +V REII+RD NRFHCF+ G+CSCR FW Sbjct: 469 KNLRVCEDCHAALKIISGIVSREIIVRDRNRFHCFRDGQCSCRDFW 514 >ref|XP_002870024.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315860|gb|EFH46283.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 871 Score = 70.9 bits (172), Expect = 1e-10 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +2 Query: 2 KNIRICKDCHDFMVHLTLLVHREIIIRDGNRFHCFKKGECSCRGFW 139 KN+R+C DCH+ ++ L REI++RD NRFH FK G CSCRGFW Sbjct: 826 KNLRVCGDCHEMAKFMSKLTRREIVLRDSNRFHQFKDGHCSCRGFW 871